Labshake search
Citations for Peprotech :
1 - 50 of 1759 citations for Recombinant Human CD3D & CD3E Flag Fc & His Fc tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... and 230 µL of media (RPMI with 0.5 % FCS) with human recombinant CCL21 (200ng/ml) (Peprotech) was placed in the lower chamber ...
-
bioRxiv - Immunology 2022Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Immunology 2023Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Cancer Biology 2023Quote: ... 10% FCS and 10 ng/ml human IL3 (Peprotech, cat no 200-03). MOLM1 ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cancer Biology 2021Quote: ... recombinant human cytokines (PeproTech: 100 ng/mL SCF ...
-
bioRxiv - Immunology 2020Quote: ... Human recombinant TNF (PeproTech) was dissolved in RPMI and used at a final concentration of 10ng/mL for the indicated times ...
-
bioRxiv - Cancer Biology 2019Quote: ... recombinant human FGF2 (Peprotech) was added at concentrations ranging from 5 ng/ml to 80 ng/ml ...
-
bioRxiv - Cell Biology 2021Quote: ... human recombinant TNFα (PeproTech) was used at 50 ng/mL for 4 h ...
-
bioRxiv - Cell Biology 2023Quote: ... recombinant human BMP4 (Peprotech) was added to the culture to the final concentration 1.5 nM and then the medium was changed every third day ...
-
bioRxiv - Cancer Biology 2023Quote: ... recombinant human TPO (PeproTech), and 10ng/ml recombinant human IL-3 (Gibco) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant Human BMP7 (Peprotech) was delivered on a daily basis with a dose of 100 ug/kg/day dissolved in water for 12 days ...
-
bioRxiv - Bioengineering 2023Quote: ... human recombinant WNT1A (Peprotech) at 20ng/μl and 0.5μM LDN193189 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human BAFF (Peprotech 310-13 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human IL2 (Peprotech) was added at indicated concentrations.
-
bioRxiv - Microbiology 2020Quote: ... recombinant human IL-10 (Peprotech) was added to the culture medium ...
-
bioRxiv - Immunology 2019Quote: ... Recombinant human IL-2 (Peprotech) was provided at 100 U/mL ...
-
bioRxiv - Neuroscience 2021Quote: ... as human recombinant proteins (Peprotech). APOE3 was resuspended in 20 mM Sodium Phosphate ...
-
bioRxiv - Immunology 2022Quote: ... human recombinant thrombopoietin (TPO) (PeproTech), human recombinant Fms-related tyrosine kinase 3 ligand (FLT3-L ...
-
bioRxiv - Cancer Biology 2022Quote: ... recombinant human heregulin (HRG, PeproTech), and bafilomycin A1 were added at the indicated doses and time points ...
-
bioRxiv - Molecular Biology 2019Quote: ... 10μg recombinant human LIF (Peprotech). Cells were maintained in 20% O2 conditions on irradiation inactivated mouse embryonic fibroblast (MEF ...
-
bioRxiv - Developmental Biology 2020Quote: ... 10μg recombinant human LIF (Peprotech). Cells were maintained in 20% O2 conditions on irradiation inactivated mouse embryonic fibroblast (MEF ...
-
bioRxiv - Immunology 2023Quote: ... 2.5µg human recombinant IL2 (Peprotech) was administered subcutaneously (s.c. ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human IL-4 (Peprotech 200-04 ...
-
bioRxiv - Immunology 2023Quote: Recombinant human IL-2 (Peprotech 200-02 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human IL-21 (Peprotech 200-21 ...
-
bioRxiv - Cell Biology 2023Quote: ... containing 5% FCS and additional 100ng/mL M-CSF (PeproTech) with incubator conditions 37°C/5% CO2 ...
-
bioRxiv - Developmental Biology 2020Quote: ... recombinant human SCF (10ng/ml, Peprotech), SRCi CGP77675 (CGP77675 1µM – Axon Medchem 2097) ...
-
bioRxiv - Developmental Biology 2020Quote: ... recombinant human IGF1 (10ng/ml, Peprotech), Forskolin (FK ...
-
bioRxiv - Developmental Biology 2019Quote: ... 20ng/mL recombinant human LIF (Peprotech), 3µM CHIR99021 (Tocris or Peprotech) ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... recombinant human BDNF (#450-02, Peprotech), and k252a (TRK inhibitor ...
-
bioRxiv - Cell Biology 2019Quote: ... recombinant human TNF (Peprotech, 300-01A), recombinant human TRAIL (Peprotech ...
-
bioRxiv - Cell Biology 2019Quote: ... recombinant human TRAIL (Peprotech, 310-04), Lipopolysaccharide (LPS ...
-
bioRxiv - Immunology 2021Quote: ... Recombinant human Flt3L (300-19, Peprotech) and recombinant murine GM- CSF (315-03 ...
-
bioRxiv - Immunology 2020Quote: Mouse and human recombinant TNF (Peprotech), zVAD-fmk (Calbiochem and Bachem) ...
-
bioRxiv - Bioengineering 2021Quote: ... Recombinant human FGF19 (100ng/ml, PeproTech) was added to culture on day 14 post-seeding ...
-
bioRxiv - Bioengineering 2021Quote: ... Recombinant human SDF1 (300ng/ml, PeproTech) was added to culture on day 28 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Recombinant human TNF-alpha (PeproTech/VWR) was used at a concentration of 10 ng/ml.
-
bioRxiv - Bioengineering 2019Quote: ... Recombinant human BMP2 (Peprotech 120-02) was diluted to 50 μg/ml in PBS ...
-
bioRxiv - Developmental Biology 2020Quote: ... FGF2 (Recombinant Human FGF basic, Peprotech), RA (Sigma-Aldrich) ...
-
bioRxiv - Immunology 2020Quote: ... and human recombinant M-CSF (Peprotech) (20 ng/ml ...
-
bioRxiv - Systems Biology 2019Quote: ... 100ng/mL recombinant human TNF (Peprotech) was applied for a further 30mins ...
-
bioRxiv - Cancer Biology 2020Quote: ... 50ng/ml recombinant human EGF (Peprotech) and 100ng/ml Recombinant murine Noggin (Peprotech) ...
-
bioRxiv - Cancer Biology 2020Quote: ... 25ng/ml recombinant human HGF (Peprotech), 10μM Forskolin (Sigma ...
-
bioRxiv - Cancer Biology 2020Quote: ... 100ng/ml recombinant human FGF10 (Peprotech), 25ng/ml recombinant human HGF (Peprotech) ...
-
bioRxiv - Cancer Biology 2020Quote: ... 50ng/ml recombinant human EGF (Peprotech), 100ng/ml recombinant human FGF10 (Peprotech) ...