Labshake search
Citations for Peprotech :
1 - 50 of 1330 citations for Recombinant Cynomolgus CD3E & CD3D His Fc & Flag Fc tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Immunology 2023Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Immunology 2023Quote: ... and 230 µL of media (RPMI with 0.5 % FCS) with human recombinant CCL21 (200ng/ml) (Peprotech) was placed in the lower chamber ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cell Biology 2023Quote: ... containing 5% FCS and additional 100ng/mL M-CSF (PeproTech) with incubator conditions 37°C/5% CO2 ...
-
bioRxiv - Immunology 2023Quote: ... 5% FCS and antibiotics supplemented with 120 U/mL IL-2 (Peprotech), 20 ng/mL IL-7 (Research grade ...
-
bioRxiv - Microbiology 2020Quote: ... supplemented with 20% FCS and 2.5 ng x ml−1 GM-CSF (Peprotech). After 5-7 days ...
-
bioRxiv - Microbiology 2020Quote: ... supplemented with 20% FCS and 2.5 ng x ml-1 GM-CSF (Peprotech). After 5-7 days ...
-
bioRxiv - Cancer Biology 2023Quote: ... 10% FCS and 10 ng/ml human IL3 (Peprotech, cat no 200-03). MOLM1 ...
-
bioRxiv - Immunology 2021Quote: ... and hip bones in RPMI containing 10% FCS buffer with 10 ng/mL IL6 (Peprotech, 216-16). A red blood cell lysis step was performed in 4 mL ACK lysis buffer for 1 minute at room temperature and subsequently inactivated with 26 mL RPMI containing 10% FCS ...
-
bioRxiv - Immunology 2023Quote: ... supplemented with 5% heat-inactivated FCS (LabTech #80837) and 50 ng/ml M-CSF (PeproTech #300-25) for 7 days.
-
bioRxiv - Microbiology 2020Quote: ... Macrophages were generated from adherent cells in RPMI-1640 containing 10% FCS and M-CSF (Peprotech, 315-02) (30 ng/ml ...
-
bioRxiv - Molecular Biology 2023Quote: ... macrophages were generated from adherent cells in RPMI-1640 containing 10% FCS and M-CSF (Peprotech, 315-02) (30 ng/ml ...
-
bioRxiv - Biophysics 2021Quote: ... the medium was replaced by RPMI containing 10% FCS and 20 ng/mL of Macrophage Colony-Stimulating Factor (M-CSF) (Peprotech). For experiments ...
-
bioRxiv - Cell Biology 2021Quote: ... the remaining one-third of the chamber was filled with complete RPMI 1640 supplemented with 10% FCS in the presence or absence of 0.6 μg/ml murine CCL19 (Peprotech, USA). The slowly diffusing CCL19-containing medium creates a CCL19 gradient that promotes BMDC migration towards the upper part of the chamber.
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Immunology 2020Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2022Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2020Quote: ... cells were seeded in complete DMEM medium (10% FCS, 1000 U/ml Penicillin, 100 µg/ml Streptomycin) containing 30 ng/mL of mouse M-CSF (Peprotech). After two successive medium replacement (at D3 and D6) ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Immunology 2019Quote: ... bone marrow cells were plated at a density of 5×105 cells/mL in RPMI-1640 + 10% FCS + 100 U/mL penicillin/streptomycin + 1 mM β-mercaptoethanol (BM medium) with 20 ng/mL murine GM-CSF (Peprotech) and cultures in a humidified environment at 37°C and 5% CO2 ...
-
bioRxiv - Cancer Biology 2019Quote: ... Samples were examined by ELISA capturing with Fc-iNKG2D and detecting with biotinylated rabbit-anti-human IL-2 polyclonal antibody (Peprotech #500-P22BT) followed by incubation with streptavidin-HRP ...
-
bioRxiv - Cell Biology 2021Quote: ... were flushed out and differentiated by culturing in DMEM-10% FCS supplemented with mouse colony stimulating factor (M-CSF, 25ng/ml, Peprotech, 315-02) for 5-6 days ...
-
bioRxiv - Immunology 2022Quote: A single cell suspension was prepared by flushing the bone marrow from the hind legs in RPMI containing 10% FCS buffer with 10 ng/mL IL6 (Peprotech, 216-16). A red blood cell lysis step was performed in 2 mL ammonium-chloride-potassium (ACK ...
-
bioRxiv - Biochemistry 2024Quote: ... Medium was replaced 24 h later with DMEM-10% FCS supplemented or not with 50 ng/ml human IL-1β (PeproTech, 200-01B). Luciferase activity was measured 5 h later using Bright-Glo Luciferase Assay System (Promega ...
-
bioRxiv - Cancer Biology 2024Quote: ... 1% mouse recombinant EGF (Invitrogen, 5% Recombinant human R-spondin (Peprotech).
-
bioRxiv - Cancer Biology 2021Quote: ... recombinant human cytokines (PeproTech: 100 ng/mL SCF ...
-
bioRxiv - Cancer Biology 2020Quote: ... recombinant GDNF from Peprotech.
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: ... recombinant murine CCL2 (Peprotech) and recombinant murine CXCL1 (Peprotech ...
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: Recombinant murine CCL2 (Peprotech) and recombinant murine CXCL1 (Peprotech ...
-
bioRxiv - Immunology 2020Quote: ... Human recombinant TNF (PeproTech) was dissolved in RPMI and used at a final concentration of 10ng/mL for the indicated times ...
-
bioRxiv - Cancer Biology 2019Quote: ... recombinant human FGF2 (Peprotech) was added at concentrations ranging from 5 ng/ml to 80 ng/ml ...
-
bioRxiv - Cell Biology 2021Quote: ... human recombinant TNFα (PeproTech) was used at 50 ng/mL for 4 h ...
-
bioRxiv - Cell Biology 2023Quote: ... recombinant human BMP4 (Peprotech) was added to the culture to the final concentration 1.5 nM and then the medium was changed every third day ...
-
bioRxiv - Cancer Biology 2023Quote: ... recombinant human TPO (PeproTech), and 10ng/ml recombinant human IL-3 (Gibco) ...
-
bioRxiv - Developmental Biology 2023Quote: ... with recombinant cytokines (PeproTech): murine stem cell factor (SCF ...
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant Human BMP7 (Peprotech) was delivered on a daily basis with a dose of 100 ug/kg/day dissolved in water for 12 days ...
-
bioRxiv - Bioengineering 2023Quote: ... human recombinant WNT1A (Peprotech) at 20ng/μl and 0.5μM LDN193189 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human BAFF (Peprotech 310-13 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human IL2 (Peprotech) was added at indicated concentrations.
-
bioRxiv - Microbiology 2020Quote: ... recombinant human IL-10 (Peprotech) was added to the culture medium ...
-
bioRxiv - Immunology 2021Quote: ... Mouse recombinant IL-21 (PeproTech) was added to co-cultures at 10ng/ml ...
-
bioRxiv - Immunology 2019Quote: ... Recombinant human IL-2 (Peprotech) was provided at 100 U/mL ...
-
bioRxiv - Immunology 2021Quote: ... recombinant mouse IL-12 (Peprotech) and anti-IL-4 (BioXCell) ...
-
bioRxiv - Neuroscience 2021Quote: ... as human recombinant proteins (Peprotech). APOE3 was resuspended in 20 mM Sodium Phosphate ...