Labshake search
Citations for Peprotech :
1 - 50 of 1365 citations for Recombinant Bovine IL3 Protein since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Genomics 2023Quote: ... 20ng/ml IL3 (Peprotech), 20ng/ml IL6 (Peprotech) ...
-
bioRxiv - Cancer Biology 2023Quote: ... IL3 (PEPROTech, 200-03), and FLT3 (PEPROTech ...
-
bioRxiv - Cell Biology 2023Quote: ... and IL3 (10ng/ml, PeproTech) and incubated in a normoxic incubator (20% O2 ...
-
bioRxiv - Cell Biology 2023Quote: ... IL3 (2ng/ml) from Peprotech and EPO (2U/ml) ...
-
bioRxiv - Molecular Biology 2019Quote: ... 5ng/ml IL3 (Peprotech, 213-13).
-
bioRxiv - Cell Biology 2021Quote: ... 5ng/ml IL3 and IL6 (PeproTech). Cells were transfected the day after with 0.5ul of a 100uM stock Cy3 labeled RNA oligos using Lipofectamine Stem (Invitrogen ...
-
bioRxiv - Genomics 2023Quote: ... 5ng/ml IL3 (Peprotech, 213-13). PUER cells were differentiated into macrophages by adding 200nM 4-hydroxy-tamoxifen (OHT ...
-
bioRxiv - Molecular Biology 2023Quote: ... 5ng/ml IL3 (Peprotech, 213-13). PUER cells were differentiated into macrophages by adding 200nM 4-hydroxytamoxifen (OHT ...
-
bioRxiv - Cancer Biology 2020Quote: ... Ba/F3 cells and Ba/F7 cells were maintained in medium supplemented with 10 ng/ml recombinant mouse interleukin 3 (IL3) and interleukin 7 (IL7) (PeproTech), respectively ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cancer Biology 2022Quote: ... 5 ng/mL IL3 (Cat # 200-03, Peprotech) and 2 ng/μL rhIFNγ (R&D Systems ...
-
bioRxiv - Cancer Biology 2022Quote: ... 5 ng/mL IL3 (Cat # 200-03, Peprotech), 10 ng/mL G-CSF (Cat# 300-23 ...
-
bioRxiv - Cell Biology 2020Quote: ... and cytokines such as 20 ng/ml IL3 (PeproTech), 20 ng/ml IL6 (PeproTech) ...
-
bioRxiv - Neuroscience 2021Quote: ... as human recombinant proteins (Peprotech). APOE3 was resuspended in 20 mM Sodium Phosphate ...
-
bioRxiv - Cancer Biology 2022Quote: ... and 10 ng/μL each of IL3 and IL6 (Peprotech). 293FT and HeLa (Invitrogen ...
-
bioRxiv - Developmental Biology 2024Quote: ... containing recombinant human FGF10 protein (PeproTech) was overlaid on explants and allowed to solidify for 15 min at 37°C ...
-
bioRxiv - Neuroscience 2021Quote: ... Recombinant BDNF human protein (Peprotech, #450-02) was added to ACSF at 100ng/ml ...
-
bioRxiv - Neuroscience 2021Quote: ... Recombinant BDNF human protein (Peprotech, #450-02) was added to ACSF at 100ng/ml ...
-
bioRxiv - Cancer Biology 2022Quote: ... recombinant Noggin protein (100 ng/ml, Peprotech), epidermal growth factor (EGF ...
-
bioRxiv - Cell Biology 2023Quote: ... recombinant Noggin protein (0.1 μg/ml, Peprotech), epidermal growth factor (EGF ...
-
bioRxiv - Cell Biology 2021Quote: ... the human recombinant protein (PeproTech, Rocky Hill, NJ) was used at a final concentration of 10 ng/ml.
-
bioRxiv - Cancer Biology 2023Quote: ... 10% FCS and 10 ng/ml human IL3 (Peprotech, cat no 200-03). MOLM1 ...
-
bioRxiv - Molecular Biology 2020Quote: ... The recombinant murine IFN-γ protein was purchased from PeproTech Inc ...
-
MET functions in tumour progression and therapy resistance are repressed by intronic polyadenylationbioRxiv - Molecular Biology 2023Quote: ... cells were stimulated with 50ng/mL recombinant HGF protein (Peprotech) or mock preparation for 15 min.
-
bioRxiv - Biochemistry 2023Quote: ... human recombinant IL-1β and TNF-α proteins from PeproTech (UK). A clinicaltrials.gov search on February 13 ...
-
bioRxiv - Biochemistry 2023Quote: ... Recombinant Human IL-6 protein was purchased from Peprotech (Cranbury, USA) Albumin from human serum (HSA ...
-
bioRxiv - Cell Biology 2024Quote: 0.15 ug/ml of recombinant mouse protein CXCL9 (Peprotech, Cat #: 250-18) and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech ...
-
bioRxiv - Molecular Biology 2019Quote: ... WNT3A recombinant protein (Cat#315-20) was purchased from PeproTech (Rocky Hill, NJ). WNT8A (Cat#8419-WN-010/CF ...
-
bioRxiv - Cell Biology 2023Quote: ... Recombinant HCC-1 protein (20ng/ml, PP-300-38B-2, Peprotech, United States) was added to cell culture medium ...
-
bioRxiv - Cell Biology 2024Quote: ... and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech, Cat #: 250-16) pure ligands were plated in the bottom well of a 96 well transwell (Corning ...
-
bioRxiv - Bioengineering 2023Quote: ... recombinant human Wnt-7a protein (PeproTech, cat# 120-31, 10-300 ng/mL), lithium chloride (LiCl ...
-
bioRxiv - Cancer Biology 2022Quote: ... freshly sorted Lin-CD150+CD48-bone marrow cells were seeded at 3,000 cells per well in 96 well plates and cultured in SFEM supplemented with 10 ng/mL IL3 (Peprotech), 10 ng/mL IL6 (Peprotech) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Cells were differentiated into neutrophils by replacing IL3 with 10ng/ml Granulocyte Colony Stimulating Factor (GCSF; Peprotech, 300-23) and inducing with 100nM 4-hydroxy-tamoxifen (OHT ...
-
bioRxiv - Genomics 2023Quote: ... Cells were differentiated into neutrophils by replacing IL3 with 10ng/ml Granulocyte Colony Stimulating Factor (GCSF; Peprotech, 300-23) and inducing with 100nM OHT after 48 hours.
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL human recombinant Bone Morphogenic Protein 4 (BMP4, Peprotech, AF-120-05ET), 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF ...
-
bioRxiv - Immunology 2022Quote: ... Recombinant murine macrophage chemoattractant protein 1 (MCP-1) (20 ng/mL; Peprotech, NJ, USA) was used as a positive control ...
-
bioRxiv - Developmental Biology 2023Quote: ... 5 nM recombinant human bone morphogenetic protein 4 (BMP4; Peprotech, # AF-120-05ET, USA) and 2 µM Smoothened agonist (SAG ...
-
bioRxiv - Cell Biology 2023Quote: ... and the interferon gamma recombinant protein (300-02) from Peprotech (Rocky Hill, NJ, USA), TOTO-3 (T-3604) ...
-
FOXO dictate initiation of B cell development and myeloid restriction in common lymphoid progenitorsbioRxiv - Immunology 2022Quote: ... 25ng/ml human FL and 10ng/ml murine IL3 with or without 25ng/ml murine M-CSF (all from PeproTech). No apparent difference was observed between cultures with or without M-CSF and data was combined ...
-
bioRxiv - Immunology 2023Quote: ... supplemented with 5% heat-inactivated fetal bovine serum (Biosera FB-1001) and 50ng/ml recombinant M-CSF (Peprotech 300-25). Differentiated macrophages were plated at a density of 1 x 106ml in the appropriate cell culture plate at least 1 d prior to stimulation.
-
bioRxiv - Cancer Biology 2022Quote: ... Cells were afterwards stimulated with indicated amount of recombinant protein CXCL2 (250-15-20, PeproTech GmbH) in DMEM medium without FCS or conditioned medium of endothelial cells.
-
bioRxiv - Cancer Biology 2023Quote: ... or c) supplemented with recombinant human IGFBP5 protein (500 ng/ml; Peprotech, Rocky Hill, NJ, USA). Cell lysates were obtained using RIPA buffer with the Halt Protease and Phosphatase Inhibitor Cocktail (Thermo Fisher ...
-
bioRxiv - Cancer Biology 2024Quote: ... 1% mouse recombinant EGF (Invitrogen, 5% Recombinant human R-spondin (Peprotech).
-
bioRxiv - Immunology 2020Quote: ... 1640 Medium supplemented with 10% fetal bovine serum (35-076-CV; Coring, New York, USA) and 20 ng/μL Recombinant Human GM-CSF (300-03; Peprotech, Rocky Hill, USA).BEAS-2B cells (CRL-9609 ...
-
bioRxiv - Molecular Biology 2021Quote: ... BMDM and AM were cultured in Dulbeccòs Modified Eagle’s Medium (DMEM) + 10% heat-inactivated fetal bovine serum (FBS) supplemented with 20 ng/ml recombinant murine M-CSF (PeproTech, Rocky Hill, NJ) and 20 ng/ml recombinant murine RANKL (PeproTech) ...
-
bioRxiv - Cancer Biology 2021Quote: ... recombinant human cytokines (PeproTech: 100 ng/mL SCF ...
-
bioRxiv - Cancer Biology 2020Quote: ... recombinant GDNF from Peprotech.
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: ... recombinant murine CCL2 (Peprotech) and recombinant murine CXCL1 (Peprotech ...
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: Recombinant murine CCL2 (Peprotech) and recombinant murine CXCL1 (Peprotech ...
-
bioRxiv - Immunology 2020Quote: ... Human recombinant TNF (PeproTech) was dissolved in RPMI and used at a final concentration of 10ng/mL for the indicated times ...