Labshake search
Citations for Peprotech :
1 - 50 of 78 citations for Penicillin G since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2019Quote: ... and G-CSF (Peprotech). All cells were cultured at 37 °C and 5% CO2.
-
bioRxiv - Immunology 2019Quote: ... G-CSF (20ng/ml; Peprotech), IL-3 (5ng/ml ...
-
bioRxiv - Cancer Biology 2022Quote: ... recombinant murine G-CSF (Peprotech) at 50 ng/mL was added to the culture ...
-
bioRxiv - Cancer Biology 2023Quote: ... G-CSF (10ng/ml, PeproTech), and GM-CSF (10ng/ml ...
-
bioRxiv - Genomics 2023Quote: ... 20ng/ml G-CSF (Peprotech), 20ng/ml SCF (Peprotech) ...
-
bioRxiv - Cell Biology 2020Quote: ... 1% penicillin streptomycin and 2.5ng/ml bFGF (Peprotech).
-
bioRxiv - Cancer Biology 2019Quote: ... G-CSF and GM-CSF (Peprotech) for up to 6 days in the presence of mebendazole or DMSO ...
-
bioRxiv - Immunology 2023Quote: ... G-CSF (103 U/mL; PeproTech), granulocyte-macrophage colony stimulating factor (M-CSF ...
-
bioRxiv - Cell Biology 2023Quote: ... 1% penicillin/streptomycin and 50ng/mL M-CSF(Peprotech).
-
bioRxiv - Synthetic Biology 2024Quote: ... Penicillin-Streptomycin (0.5%) and IL-2 (1000U/mL, Peprotech), as previously described50 ...
-
bioRxiv - Immunology 2019Quote: ... 1.5□g of recombinant IL-2 (Peprotech) and 7.5□g of functional grade anti-IL-2 antibody (JES6-1 ...
-
bioRxiv - Immunology 2022Quote: ... 5 ng/mL murine G-CSF (Peprotech) was added to media on the day of β-estradiol withdrawal ...
-
bioRxiv - Cancer Biology 2023Quote: ... and G-CSF (Cat: 250-05, Peprotech). Cells were harvested and analyzed by FACS after four days of culture.
-
bioRxiv - Cell Biology 2023Quote: ... human G-CSF (150 ng/mL; PeproTech), and Am580 retinoic acid agonist 2.5 μM (STEMCELL Technologies ...
-
bioRxiv - Physiology 2021Quote: ... 1% penicillin/streptomycin and M-CSF (25 ng/mL, PeproTech) for 48 hours ...
-
bioRxiv - Biochemistry 2019Quote: ... 1% penicillin/streptomycin and 5 ng/ml GM-CSF (PeproTech) at 5% CO2 and 37 °C ...
-
bioRxiv - Immunology 2023Quote: ... and penicillin/streptomycin supplemented with 1ng/mL hIL-15 (PeproTech) and cultured overnight at 37°C with 5% CO2 ...
-
bioRxiv - Microbiology 2021Quote: ... and 20ng/ml recombinant murine interferon-g (Peprotech) (IFNg ...
-
bioRxiv - Bioengineering 2022Quote: ... and human G-CSF (150 ng/mL; PeproTech).
-
bioRxiv - Immunology 2022Quote: ... 100 U/mL penicillin-streptomycin and the following cytokines (all PeproTech): IL-3 (10 ng/mL) ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1% penicillin/streptomycin and 10 ng/mL of PDGF-BB (PeproTech).
-
bioRxiv - Cancer Biology 2022Quote: ... 10 ng/mL G-CSF (Cat# 300-23, Peprotech), 10 ng/mL GM-CSF (Cat# 300- 03 ...
-
bioRxiv - Immunology 2023Quote: ... and 100 ng/ml G-CSF (Peprotech, 300-23)) ...
-
bioRxiv - Cell Biology 2023Quote: ... 20 ng/mL h-G-CSF final concentration (PeproTech). Half of the medium was removed every two days and cell density was adjusted to 500 000 cells/mL with fresh medium (or 300 000 cells/mL before weekends).
-
bioRxiv - Immunology 2022Quote: ... 100 U/mL Penicillin-Streptomycin and 100 ng/mL M-CSF (Peprotech).
-
bioRxiv - Cell Biology 2022Quote: ... 1X-penicillin/streptomycin and human recombinant BMP-2 (100 ng/ml, Peprotech).16 Chondrogenic media and growth factor were changed every other day until the end of 21 days of chondrogenic differentiation ...
-
bioRxiv - Cancer Biology 2024Quote: ... 1% streptomycin/penicillin and 50ng/mL of M-CSF (Peprotech #300-25) and kept at 37°C and 5% CO2 for 5 days to allow macrophage differentiation ...
-
bioRxiv - Neuroscience 2020Quote: ... 100 U/ml penicillin-Streptomycin] and 25 ng/ml βFGF (Peprotech, 100-18B) and 25 ng/ml Activin A (Peprotech ...
-
bioRxiv - Biochemistry 2020Quote: ... 1% penicillin/streptomycin and 5 ng/mL granulocyte-macrophage colony-stimulating factor (PeproTech) at 5% CO2 and 37 °C ...
-
bioRxiv - Immunology 2023Quote: ... 1% penicillin/streptomycin and 10ng/mL M-CSF (Peprotech, 315-02; Cranbury, NJ). Cells were seeded in chamber slides (Thermo Fisher ...
-
bioRxiv - Bioengineering 2022Quote: ... recombinant human G-CSF (300-23, Peprotech, lots: 041777 and 041877) was reacted with sulfo-Cy5 NHS ester (13320 ...
-
bioRxiv - Immunology 2021Quote: ... 1% penicillin- streptomycin-glutamine and 25 units/mL of IL-2 (Peprotech, #200-02), exchanging half the medium every 2-3 days ...
-
bioRxiv - Neuroscience 2020Quote: ... 100 U/ml penicillin/streptomycin) containing the growth factors (Gfs) EGF and FGF2 (20 ng/mL [Peprotech]). Using a radio-immunoassay ...
-
bioRxiv - Cancer Biology 2022Quote: ... IL-6 and G-CSF (all from Peprotech or Stem Cell Technologies).
-
bioRxiv - Cell Biology 2021Quote: ... 1% penicillin/streptomycin and 2.5 ng/mL bFGF (Recombinant Human FGF-basic. Peprotech; Cat# 100-18B). For growing human primary muscle progenitors ...
-
bioRxiv - Developmental Biology 2020Quote: ... 1% penicillin-streptomycin and with or without 2i-PD0325901 (1 μM) and CHIR99021 (3 μM) (PeproTech). All TSCs and iTSCs were grown in TSC medium containing a combination of 70% MEF conditioned medium and 30% freshly prepared medium ...
-
bioRxiv - Developmental Biology 2023Quote: ... 1% Penicillin-Streptomycin (BI 03-031-1B) and 8 ng/mL bFGF (Peprotech 100-18B-1MG).
-
bioRxiv - Neuroscience 2023Quote: ... 1% penicillin-streptomycin (v/v) and heparin in the presence of 20 ng/ml FGF2 (Peprotech) and 20 ng/ml EGF (Peprotech) ...
-
bioRxiv - Cell Biology 2023Quote: ... this was supplemented with SCF (25 ng/ml) and G-CSF (25 ng/ml, PeproTech). PBS or OSM was added at 500ng/ml to both medias ...
-
bioRxiv - Neuroscience 2022Quote: ... 50 U/mL penicillin/streptomycin (Biological Industries, 03-031-1B) and 100 ng/mL IL-34 (Peprotech, 200-34). Following 6 hrs ...
-
bioRxiv - Cancer Biology 2022Quote: ... The cells were then pipetted into penicillin-streptomycin free StemSpan SFEM medium with thrombopoietin (TPO; 20 ng/mL; PeproTech) and stem cell factor (SCF ...
-
bioRxiv - Cell Biology 2022Quote: Isolated FAPs were seeded at ∼10,000 cells per 1.0 cm2 well in Growth Media (10% FBS and 1x Penicillin-Streptomycin in DMEM) containing 2.5 ng/mL bFGF (Peprotech) on laminin (Gibco ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... penicillin–streptomycin (Biological Industries, 03-031-1B) and 4ul bFGF solution (10 μg/mL) per 10 mL (Peprotech, 100-18B), at 37 °C in a humidified incubator with 5% CO2 ...
-
bioRxiv - Neuroscience 2021Quote: ... 1% penicillin/streptomycin) was changed every 3-5 days and M-CSF was supplemented (Peprotech 315-02, 5 ng/mL) for 2 weeks ...
-
bioRxiv - Cell Biology 2021Quote: ... 100 U/ml penicillin and 100 µg/ml streptomycin sulfate (Nacalai Tesque) and 4 ng/ml basic fibroblast growth factor (Peprotech).
-
bioRxiv - Neuroscience 2022Quote: ... cells were changed into fresh iNI media (Neurobasal with SM1 supplement, 1% Penicillin/Streptomycin, and 1% GlutaMAX) containing BDNF (10 ng/µL; Peprotech), GDNF (10 ng/µL ...
-
bioRxiv - Immunology 2020Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2022Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2020Quote: ... cells were seeded in complete DMEM medium (10% FCS, 1000 U/ml Penicillin, 100 µg/ml Streptomycin) containing 30 ng/mL of mouse M-CSF (Peprotech). After two successive medium replacement (at D3 and D6) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...