Labshake search
Citations for Peprotech :
1 - 50 of 53 citations for L Asparagine H2O 13C4 99% since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: ... By treating platelets with soluble full-length OPN (0.01 µg/µL in H2O) (PeproTech, #120-35) and soluble cleaved OPN (0.01 µg/µL) ...
-
bioRxiv - Neuroscience 2021Quote: ... Cells were treated with either vehicle (equal volume added of 0.1% BSA in H2O) or 100nM BDNF recombinant protein (Peprotech, #450-02 ...
-
bioRxiv - Cell Biology 2023Quote: ... and Flt3-L (PeproTech) in the presence or absence of 10 µM AMD3100 or 250 nM Rapamycin ...
-
bioRxiv - Neuroscience 2021Quote: ... 0.01 ng/ L BDNF (Peprotech), 0.01 ng/ L GDNF (Peprotech) ...
-
bioRxiv - Neuroscience 2021Quote: ... 0.01 ng/ L GDNF (Peprotech), 0.001 ng/ L TGF 3 (Peprotech) ...
-
bioRxiv - Genomics 2023Quote: ... 20ng/ml Flt3-L (Peprotech), 50ng/ml TPO (Peprotech) ...
-
bioRxiv - Cancer Biology 2023Quote: ... Flt3-l (50ng/mL; Peprotech), Scf (100ng/mL ...
-
bioRxiv - Cell Biology 2023Quote: ... 40µg/l FGF2-3 (Cat. # Qk053; Qkine) and 2 µg/l TGFβ1 (Cat. # 100-21; Peprotech). For time lapse experiments ...
-
bioRxiv - Cancer Biology 2019Quote: ... E-Selectin or L-selectin (PeproTech), and incubated at room temperature for 2 hours ...
-
bioRxiv - Neuroscience 2021Quote: ... 0.001 ng/ L TGF 3 (Peprotech), 2.5 M dbcAMP (Sigma Aldrich ...
-
bioRxiv - Immunology 2021Quote: ... 100 ng/mL Flt3-L (Peprotech), 50 ng/mL TPO (Peprotech) ...
-
bioRxiv - Immunology 2021Quote: ... and Flt3-L (5 ng/ml, PeproTech). On day 2 and day 4 ...
-
bioRxiv - Cell Biology 2020Quote: ... 5ug/L FGF-basic (100-18B, PeproTech). For proliferation analysis ...
-
bioRxiv - Neuroscience 2022Quote: ... containing human BDNF (10 ug/L, Peprotech), human NT-3 (10 ug/L ...
-
bioRxiv - Cell Biology 2019Quote: ... 100µg/l FGF2 (Cat. # 100-18B; Peprotech) and 2 µg/l TGFβ1 (Cat ...
-
bioRxiv - Neuroscience 2022Quote: ... human NT-3 (10 ug/L, Peprotech), and mouse laminin (0.2 mg/L ...
-
bioRxiv - Synthetic Biology 2022Quote: ... 50 ng/ml Flt3-L (Peprotech, 250-31L), 10 ng/ml IL-6 (Peprotech ...
-
bioRxiv - Cell Biology 2023Quote: ... human Neurotrophin-3 (NT-3,10 ng/l, PeproTech), human recombinant laminin (0.2 mg/ml ...
-
bioRxiv - Genomics 2022Quote: ... FLT3-L (50ng/mL; PeproTech Cat. 250-31L), IL-11 (50ng/mL ...
-
bioRxiv - Developmental Biology 2023Quote: ... 20ng/ml Flt3-L (all cytokines from PeproTech). Colony forming units (CFU ...
-
Single-cell transcription mapping of murine and human mammary organoids responses to female hormonesbioRxiv - Developmental Biology 2023Quote: ... 5 nmol/L Neuregulin 1 (Peprotech, 100–03), 5 ng/mL FGF7 (Peprotech ...
-
bioRxiv - Molecular Biology 2019Quote: ... human Neurotrophin-3 (NT-3, 10 ng/l, PeproTech), mouse laminin (0.2 μg/ml ...
-
bioRxiv - Cell Biology 2019Quote: ... and 2 µg/l TGFβ1 (Cat. # 100-21; Peprotech) (Chen et al. ...
-
bioRxiv - Cell Biology 2020Quote: Human recombinant TNF-α and RANK-L were from PeproTech. Mouse monoclonal antibody to glycoprotein-2 (Gp-2 ...
-
bioRxiv - Physiology 2021Quote: ... followed by the addition of RANK-L (50 ng/mL, PeproTech) for 5 days ...
-
bioRxiv - Genetics 2021Quote: ... 10μg/L insulin-like growth factor-1 (IGF-1) (Peprotech, USA), and 1% insulin transferrin selenium (ITS ...
-
bioRxiv - Immunology 2020Quote: ... or 20 ng ml−1 IL-4 (Peprotech; MI(L-4)) ...
-
bioRxiv - Immunology 2022Quote: ... human recombinant Fms-related tyrosine kinase 3 ligand (FLT3-L) (PeproTech) until injection in mice (within 3 to 6 hours of culture ...
-
bioRxiv - Genomics 2021Quote: ... L-glutamine (100ng/mL) and the following human cytokines (all from Peprotech): SCF (20ng/mL) ...
-
bioRxiv - Genetics 2021Quote: ... 10 μg/L transforming growth factor beta-1 (TGF-β1, Peprotech, USA), 10μg/L insulin-like growth factor-1 (IGF-1 ...
-
bioRxiv - Cell Biology 2020Quote: ... the L-WRN condition medium was reduced to 5 % and supplemented with Noggin (Peprotech) and FBS.
-
bioRxiv - Cell Biology 2023Quote: ... supplemented with 50 ng/ml RANK-L and 30 ng/ml M-CSF (Peprotech) to stimulate osteoclastogenesis ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 292 ug/mL L-glutamine and 20 ng/mL human M-CSF (Peprotech) for at least 7 days ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 50 µM β-mercaptoethanol) supplemented with 50ng/mL hFIt3-L (PeproTech, 10773-618) and 2ng/mL GM-CSF (PeproTech ...
-
bioRxiv - Molecular Biology 2020Quote: ... IFN-γ (500 U/L) and IL-17 (10 ng/ml) were obtained from PeproTech. For short-term stimulation ...
-
bioRxiv - Immunology 2022Quote: ... 1 % L-Glutamin in RPMI) supplemented with 100 units/mL IL-2 (Peprotech, 200-02) for the respective amount of time ...
-
bioRxiv - Immunology 2020Quote: ... L-glutamine and antibiotics and containing 10ng/mL recombinant human IL-7 and IL-15 (Peprotech, USA).
-
bioRxiv - Neuroscience 2022Quote: To obtain neural rosettes the EBs were seeded on poly-l-ornithine/laminin (POLAM) coated plates with PN medium supplemented with Noggin (200ng/ml; Peprotech) and SB431542 (10 μM ...
-
bioRxiv - Systems Biology 2019Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech), and were sorted after 6 or 7 total days of culture before transducing with retroviral vectors or treating with small molecule inhibitors ...
-
bioRxiv - Immunology 2022Quote: ... 0.25 µg/mL Amphotericin B and 2 mM L-glutamine and treated with 10 ng/mL recombinant IL-12p70 (Peprotech) for 24 hours for supernatant IFN-γ analysis.
-
Combining LSD1 and JAK-STAT inhibition targets Down syndrome-associated myeloid leukemia at its corebioRxiv - Cancer Biology 2022Quote: ... and a cytokine cocktail (FLT3-L, SCF, IL-6, IL-3, TPO; all purchased from PeproTech, Rocky Hill, NJ, USA). Samples were taken from pediatric AML patients treated as part of the AML Berlin-Frankfurt-Münster study group ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Immunology 2023Quote: ... and cultured in complete RPMI 1640 media (10% fetal bovine serum, 1% penicillin-streptomycin, 1% L-glutamine) supplemented with 10 ng/mL M-CSF (PeproTech). Cells were cultured for 5 days at 37°C in a humidified 5% CO2 atmosphere under continuous high-dose 100 ng/mL lipopolysaccharide (LPS ...
-
bioRxiv - Immunology 2023Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Cell Biology 2023Quote: ... glutamine and human early-acting cytokines (SCF 300 ng/ml, Flt3-L 300 ng/ml, TPO 100 ng/ml, and IL-3 60 ng/ml; all purchased from Peprotech). All cultures were kept at 37°C in a 5% CO2 water jacket incubator (Thermo Scientific ...
-
bioRxiv - Cell Biology 2020Quote: ... from serial transplants were thawed and maintained in medium (DMEM with 15% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13), 10ng/ml IL-6 (Peprotech 216-1 ...
-
bioRxiv - Cell Biology 2022Quote: ... cells were lifted using accutase and plated onto Laminin-111/ poly-L-ornithine-coated plates in NIM supplemented with 10 ng/ml BDNF (Peprotech, 450-02) and 10 ng/ml GDNF (Peprotech ...
-
bioRxiv - Developmental Biology 2021Quote: ... LCDMYI supplementation was added as indicated at the following concentrations: 10 ng ml−1 recombinant human LIF (L, 10 ng ml−1; Peprotech, 300-05), CHIR99021 (C ...
-
bioRxiv - Cell Biology 2020Quote: ... were maintained in medium (RPMI with 20% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13). For in vivo experiments ...