Labshake search
Citations for Peprotech :
1 - 50 of 265 citations for Ephrin A1 EFNA1 Mouse HEK293 Fc His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2021Quote: ... TGFβ1 (HEK293 derived) and TGFβ2 (HEK293 derived) were acquired from Peprotech (Rocky Hill, NJ). Primary antibody [mouse monoclonal IgG anti-Vimentin (V9)] ...
-
bioRxiv - Immunology 2022Quote: ... human IL-12p70 (HEK293) (Peprotech) and 50ng/ml recombinant human IL-18 (MBL International ...
-
bioRxiv - Immunology 2020Quote: ... cells were seeded in complete DMEM medium (10% FCS, 1000 U/ml Penicillin, 100 µg/ml Streptomycin) containing 30 ng/mL of mouse M-CSF (Peprotech). After two successive medium replacement (at D3 and D6) ...
-
bioRxiv - Neuroscience 2023Quote: ... cells were resuspended in 320 μl of fresh DRG media (F12, 10% hi-FBS, 1% Pen/Strep, 20 ng/ml mouse GDNF (Peprotech #450-44), 50 ng/ml mouse NGF (Peprotech #450-34) ...
-
bioRxiv - Cell Biology 2021Quote: ... were flushed out and differentiated by culturing in DMEM-10% FCS supplemented with mouse colony stimulating factor (M-CSF, 25ng/ml, Peprotech, 315-02) for 5-6 days ...
-
bioRxiv - Cell Biology 2019Quote: ... 2 ng ml−1 recombinant human TGFβ1 (112 amino acid, HEK293-derived, Peprotech, 100-21). Cells were routinely maintained in E8 medium on 1:800 diluted growth factor reduced Matrigel (see below) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Cells were treated for 72 h with 10ng/ml recombinant human TGF-β1 (HEK293 derived, PEPROTECH). Cell density was monitored by an Incucyte S3 (Sartorius ...
-
bioRxiv - Cell Biology 2023Quote: ... containing 5% FCS and additional 100ng/mL M-CSF (PeproTech) with incubator conditions 37°C/5% CO2 ...
-
bioRxiv - Immunology 2022Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Immunology 2023Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Immunology 2023Quote: ... 5% FCS and antibiotics supplemented with 120 U/mL IL-2 (Peprotech), 20 ng/mL IL-7 (Research grade ...
-
bioRxiv - Neuroscience 2019Quote: ... Cells were then left unstimulated or stimulated to generate A1 polarized astrocytes by adding recombinant rat Il-1α (3 ng/mL, PeproTech, Rocky Hill, NJ), recombinant human TNFα (30 ng/mL ...
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Microbiology 2020Quote: ... supplemented with 20% FCS and 2.5 ng x ml−1 GM-CSF (Peprotech). After 5-7 days ...
-
bioRxiv - Microbiology 2020Quote: ... supplemented with 20% FCS and 2.5 ng x ml-1 GM-CSF (Peprotech). After 5-7 days ...
-
bioRxiv - Cancer Biology 2023Quote: ... 10% FCS and 10 ng/ml human IL3 (Peprotech, cat no 200-03). MOLM1 ...
-
bioRxiv - Developmental Biology 2021Quote: ... and treated with 25 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 24 hours.
-
bioRxiv - Biochemistry 2021Quote: Recombinant human platelet-derived growth factor-BB (PDGF-BB) and recombinant human transforming Growth Factor-β1 (TGFβ1; HEK293 derived) were purchased from PeproTech (Hamburg, Germany) and they were dissolved in sterile ddH2O ...
-
bioRxiv - Immunology 2023Quote: ... and 230 µL of media (RPMI with 0.5 % FCS) with human recombinant CCL21 (200ng/ml) (Peprotech) was placed in the lower chamber ...
-
bioRxiv - Immunology 2021Quote: ... and hip bones in RPMI containing 10% FCS buffer with 10 ng/mL IL6 (Peprotech, 216-16). A red blood cell lysis step was performed in 4 mL ACK lysis buffer for 1 minute at room temperature and subsequently inactivated with 26 mL RPMI containing 10% FCS ...
-
bioRxiv - Immunology 2023Quote: ... supplemented with 5% heat-inactivated FCS (LabTech #80837) and 50 ng/ml M-CSF (PeproTech #300-25) for 7 days.
-
bioRxiv - Microbiology 2020Quote: ... Macrophages were generated from adherent cells in RPMI-1640 containing 10% FCS and M-CSF (Peprotech, 315-02) (30 ng/ml ...
-
bioRxiv - Molecular Biology 2023Quote: ... macrophages were generated from adherent cells in RPMI-1640 containing 10% FCS and M-CSF (Peprotech, 315-02) (30 ng/ml ...
-
Microbial signals and lymphotoxin drive TNF-independent death of A20 and ABIN-1 deficient epitheliumbioRxiv - Immunology 2021Quote: ... Recombinant mouse IL-1β and mouse LIGHT were purchased from Peprotech. Pam3CSK4 ...
-
bioRxiv - Cell Biology 2019Quote: ... mouse IL-6 and mouse SCF (10 ng/mL each) (Peprotech) in a 6-well culture plate ...
-
bioRxiv - Immunology 2022Quote: ... mouse IL-2 (Peprotech), and human TGF-beta (Peprotech) ...
-
bioRxiv - Biophysics 2021Quote: ... the medium was replaced by RPMI containing 10% FCS and 20 ng/mL of Macrophage Colony-Stimulating Factor (M-CSF) (Peprotech). For experiments ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Cell Biology 2021Quote: ... the remaining one-third of the chamber was filled with complete RPMI 1640 supplemented with 10% FCS in the presence or absence of 0.6 μg/ml murine CCL19 (Peprotech, USA). The slowly diffusing CCL19-containing medium creates a CCL19 gradient that promotes BMDC migration towards the upper part of the chamber.
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Immunology 2020Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Immunology 2022Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Immunology 2022Quote: ... The CD34 cell purity was checked by FACS and cells were cultured in IMDM with 10% HI FBS supplemented with human cytokine and growth factor cocktail from Peprotech (hTPO (#300-18) (10 ng/ml) ...
-
bioRxiv - Immunology 2021Quote: ... Mouse recombinant IL-21 (PeproTech) was added to co-cultures at 10ng/ml ...
-
bioRxiv - Immunology 2021Quote: ... recombinant mouse IL-12 (Peprotech) and anti-IL-4 (BioXCell) ...
-
bioRxiv - Cell Biology 2021Quote: ... 10ng/mL mouse SCF (Peprotech) and 0.1% PVA (Sigma ...
-
bioRxiv - Cancer Biology 2022Quote: ... mouse SCF (20ng/µL, PeproTech), penicillin (100U/mL ...
-
bioRxiv - Cancer Biology 2022Quote: ... mouse IFN-γ from PeproTech; MRT68601 ...
-
bioRxiv - Immunology 2019Quote: ... bone marrow cells were plated at a density of 5×105 cells/mL in RPMI-1640 + 10% FCS + 100 U/mL penicillin/streptomycin + 1 mM β-mercaptoethanol (BM medium) with 20 ng/mL murine GM-CSF (Peprotech) and cultures in a humidified environment at 37°C and 5% CO2 ...
-
bioRxiv - Cancer Biology 2019Quote: ... Samples were examined by ELISA capturing with Fc-iNKG2D and detecting with biotinylated rabbit-anti-human IL-2 polyclonal antibody (Peprotech #500-P22BT) followed by incubation with streptavidin-HRP ...
-
bioRxiv - Immunology 2022Quote: A single cell suspension was prepared by flushing the bone marrow from the hind legs in RPMI containing 10% FCS buffer with 10 ng/mL IL6 (Peprotech, 216-16). A red blood cell lysis step was performed in 2 mL ammonium-chloride-potassium (ACK ...
-
bioRxiv - Biochemistry 2024Quote: ... Medium was replaced 24 h later with DMEM-10% FCS supplemented or not with 50 ng/ml human IL-1β (PeproTech, 200-01B). Luciferase activity was measured 5 h later using Bright-Glo Luciferase Assay System (Promega ...
-
bioRxiv - Bioengineering 2021Quote: ... mouse femoral head explants were stimulated using 10□ng□ml-1 recombinant mouse IL-1β (PeproTech) for 2 days ...
-
bioRxiv - Developmental Biology 2021Quote: ... recombinant mouse RANKL (100ng/ml, Peprotech) was added to the media and incubated for 4 days.