Labshake search
Citations for Peprotech :
101 - 150 of 181 citations for Rat Protein L Isoaspartate PCMT1 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2023Quote: ... and 50 µM β-mercaptoethanol) supplemented with 50ng/mL hFIt3-L (PeproTech, 10773-618) and 2ng/mL GM-CSF (PeproTech ...
-
bioRxiv - Molecular Biology 2020Quote: ... IFN-γ (500 U/L) and IL-17 (10 ng/ml) were obtained from PeproTech. For short-term stimulation ...
-
bioRxiv - Immunology 2022Quote: ... 1 % L-Glutamin in RPMI) supplemented with 100 units/mL IL-2 (Peprotech, 200-02) for the respective amount of time ...
-
bioRxiv - Cell Biology 2021Quote: ... the human recombinant protein (PeproTech, Rocky Hill, NJ) was used at a final concentration of 10 ng/ml.
-
bioRxiv - Biochemistry 2019Quote: ... The cells were subject to cytokines stimulation in serum free medium containing 10 ng/ml rat IFN-γ (Peprotech, #400-20) and 10 ng/ml rat TNF-α (Peprotech ...
-
bioRxiv - Neuroscience 2021Quote: ... Rho-associated protein kinase inhibitor (3 uM; 1293823; PeproTech) was added to the media for 1 day post replating.
-
bioRxiv - Neuroscience 2021Quote: ... Each of the three proteins were purchased from Peprotech and prepared according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2022Quote: ... 50 ng/ml bone morphogenetic protein-4 (BMP4; Peprotech), 1% penicillin-streptomycin solution (Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2022Quote: ... 10 ng/ml bone morphogenetic protein-2 (BMP2; Peprotech), 1% penicillin-streptomycin solution (Thermo Fisher Scientific ...
-
bioRxiv - Cancer Biology 2022Quote: ... macrophage inflammatory protein (MIPα, catalogue no. 300-08; PeproTech) and 0.05 ng/ml leukemia inhibitory factor (LIF ...
-
bioRxiv - Neuroscience 2023Quote: ... 1.5 nM of Bone Morphogenic Protein-4 (BMP4, Peprotech) was added to fresh NIM ...
-
bioRxiv - Immunology 2022Quote: ... 235 μL of complete DMEM supplemented with 1 % rat serum with or without chemotactic stimuli 30 ng/mL CXCL10 (PeproTech, 400-33) and CCL5 (PeproTech ...
-
bioRxiv - Immunology 2020Quote: ... L-glutamine and antibiotics and containing 10ng/mL recombinant human IL-7 and IL-15 (Peprotech, USA).
-
bioRxiv - Neuroscience 2019Quote: ... Cells were then left unstimulated or stimulated to generate A1 polarized astrocytes by adding recombinant rat Il-1α (3 ng/mL, PeproTech, Rocky Hill, NJ), recombinant human TNFα (30 ng/mL ...
-
bioRxiv - Physiology 2022Quote: ... to trigger their differentiation towards a pro-inflammatory phenotype M(LPS,IFN) or IL4 (20 ng ml−1, rat recombinant; Peprotech, London, United Kingdom) to obtain anti-inflammatory macrophages ...
-
bioRxiv - Neuroscience 2022Quote: ... 10k primary rat microglia were added to 20k DIV12 primary hippocampal neurons with 40 ng/mL of rat macrophage colony stimulating factor (MCSF) (Peprotech 400-28-100UG). At the time of plating ...
-
bioRxiv - Bioengineering 2020Quote: ... Murine IL9 based fusion proteins and commercial murine IL9 (Peprotech) were added to the cells in serial dilution (from 28 nM until 0.1 pM) ...
-
bioRxiv - Neuroscience 2022Quote: ... and 0.5 µg/ml DKK1 (Dickkopf-related protein 1; Peprotech). At 12 DIV ...
-
bioRxiv - Bioengineering 2020Quote: ... bone morphogenetic protein 4 (BMP-4, 6.7 ng/mL; Peprotech), human interleukin 3 (hIL-3 ...
-
bioRxiv - Molecular Biology 2020Quote: ... The recombinant murine IFN-γ protein was purchased from PeproTech Inc ...
-
MET functions in tumour progression and therapy resistance are repressed by intronic polyadenylationbioRxiv - Molecular Biology 2023Quote: ... cells were stimulated with 50ng/mL recombinant HGF protein (Peprotech) or mock preparation for 15 min.
-
bioRxiv - Cell Biology 2022Quote: ... cultured with bone morphogenetic protein 4 (BMP4, Peprotech, 120-05), vascular endothelial growth factor (VEGF ...
-
bioRxiv - Biochemistry 2023Quote: ... human recombinant IL-1β and TNF-α proteins from PeproTech (UK). A clinicaltrials.gov search on February 13 ...
-
bioRxiv - Cell Biology 2023Quote: ... 20 ng/mL Bone Morphogenetic Protein 4 (rBMP4, (PeproTech, 120-05) and 10 ng/mL FGF2 and cultured for 3 days ...
-
bioRxiv - Biochemistry 2023Quote: ... Recombinant Human IL-6 protein was purchased from Peprotech (Cranbury, USA) Albumin from human serum (HSA ...
-
bioRxiv - Neuroscience 2022Quote: To obtain neural rosettes the EBs were seeded on poly-l-ornithine/laminin (POLAM) coated plates with PN medium supplemented with Noggin (200ng/ml; Peprotech) and SB431542 (10 μM ...
-
bioRxiv - Systems Biology 2019Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech), and were sorted after 6 or 7 total days of culture before transducing with retroviral vectors or treating with small molecule inhibitors ...
-
bioRxiv - Immunology 2022Quote: ... 0.25 µg/mL Amphotericin B and 2 mM L-glutamine and treated with 10 ng/mL recombinant IL-12p70 (Peprotech) for 24 hours for supernatant IFN-γ analysis.
-
Combining LSD1 and JAK-STAT inhibition targets Down syndrome-associated myeloid leukemia at its corebioRxiv - Cancer Biology 2022Quote: ... and a cytokine cocktail (FLT3-L, SCF, IL-6, IL-3, TPO; all purchased from PeproTech, Rocky Hill, NJ, USA). Samples were taken from pediatric AML patients treated as part of the AML Berlin-Frankfurt-Münster study group ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Cell Biology 2023Quote: ... glutamine and human early-acting cytokines (SCF 300 ng/ml, Flt3-L 300 ng/ml, TPO 100 ng/ml, and IL-3 60 ng/ml; all purchased from Peprotech). All cultures were kept at 37°C in a 5% CO2 water jacket incubator (Thermo Scientific ...
-
bioRxiv - Immunology 2023Quote: ... and cultured in complete RPMI 1640 media (10% fetal bovine serum, 1% penicillin-streptomycin, 1% L-glutamine) supplemented with 10 ng/mL M-CSF (PeproTech). Cells were cultured for 5 days at 37°C in a humidified 5% CO2 atmosphere under continuous high-dose 100 ng/mL lipopolysaccharide (LPS ...
-
bioRxiv - Developmental Biology 2024Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech). Experiments involving in vitro generation of NK and ILC populations (Figures 3 ...
-
bioRxiv - Immunology 2024Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Neuroscience 2024Quote: ... and replated at 50000-75000 cells/cm2 in a poly-L-ornithin-laminin coated 6-well plate with neurobasal medium supplemented with 10 ng/ml PDGFaa (Peprotech), 10 ng/ml IGF1 (Peprotech) ...
-
bioRxiv - Developmental Biology 2021Quote: ... Bone morphogenetic protein 2 (BMP2, 100-200 ng/mL; Peprotech #120-02), Bone morphogenetic protein 4 (BMP4 ...
-
bioRxiv - Developmental Biology 2021Quote: ... Bone morphogenetic protein 7 (BMP7, 100-200 ng/mL; Peprotech #120-03P), Fibroblast growth factor-2 (FGF2 ...
-
bioRxiv - Developmental Biology 2021Quote: ... Bone morphogenetic protein 4 (BMP4, 100-200 ng/mL; Peprotech #315-27), Bone morphogenetic protein 7 (BMP7 ...
-
bioRxiv - Cell Biology 2024Quote: 0.15 ug/ml of recombinant mouse protein CXCL9 (Peprotech, Cat #: 250-18) and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech ...
-
bioRxiv - Biochemistry 2024Quote: ... supernatants or serial dilutions of mouse IL2 recombinant protein (Peprotech, ThermoFisher Scientific) (100 μL/well ...
-
bioRxiv - Molecular Biology 2019Quote: ... WNT3A recombinant protein (Cat#315-20) was purchased from PeproTech (Rocky Hill, NJ). WNT8A (Cat#8419-WN-010/CF ...
-
bioRxiv - Bioengineering 2023Quote: ... recombinant human Wnt-7a protein (PeproTech, cat# 120-31, 10-300 ng/mL), lithium chloride (LiCl ...
-
bioRxiv - Cell Biology 2023Quote: ... Recombinant HCC-1 protein (20ng/ml, PP-300-38B-2, Peprotech, United States) was added to cell culture medium ...
-
bioRxiv - Cell Biology 2024Quote: ... and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech, Cat #: 250-16) pure ligands were plated in the bottom well of a 96 well transwell (Corning ...
-
bioRxiv - Microbiology 2024Quote: ... Recombinant mouse M-CSF proteins were bought from Peprotech (cat no. 315-02).
-
bioRxiv - Cell Biology 2020Quote: ... from serial transplants were thawed and maintained in medium (DMEM with 15% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13), 10ng/ml IL-6 (Peprotech 216-1 ...
-
bioRxiv - Cell Biology 2022Quote: ... cells were lifted using accutase and plated onto Laminin-111/ poly-L-ornithine-coated plates in NIM supplemented with 10 ng/ml BDNF (Peprotech, 450-02) and 10 ng/ml GDNF (Peprotech ...
-
bioRxiv - Developmental Biology 2021Quote: ... LCDMYI supplementation was added as indicated at the following concentrations: 10 ng ml−1 recombinant human LIF (L, 10 ng ml−1; Peprotech, 300-05), CHIR99021 (C ...
-
bioRxiv - Cell Biology 2020Quote: ... were maintained in medium (RPMI with 20% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13). For in vivo experiments ...