Labshake search
Citations for Greiner :
201 - 250 of 430 citations for Rat Insulin like growth factor binding protein 6 IGFBP6 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Synthetic Biology 2021Quote: ... 47 Assays were performed in 96-well microplate (half area, µCLEAR, black polystyrene, medium binding, non-sterile, Greiner Bio-One) with NADH fluorescence (λEx = 340 nm ...
-
bioRxiv - Biophysics 2020Quote: ... The samples were mixed by pipetting and 18 μl were transferred into 384 well medium-binding microplates (Greiner bio-one). The samples were incubated at RT for 20 min prior to imaging ...
-
bioRxiv - Neuroscience 2021Quote: The mixtures of Aβ1-42 and the peptides were pipetted to a μclear medium binding half area plates (Greiner, #675096) and ThT was added to a final concentration of 25 μM ...
-
bioRxiv - Immunology 2020Quote: ... mybiosource TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSM FGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK) or vehicle (PBS or chloroform) were plated on a high binding 96 well flat-bottomed plate (Greiner) and left at RT overnight ...
-
bioRxiv - Microbiology 2022Quote: ... Assays were performed in 20 μL volume in 384-well Non-binding Low-volume plates (Greiner Bio-One; Monroe, NC) at ambient temperature ...
-
bioRxiv - Developmental Biology 2022Quote: ... hiPSCs were plated at 10,000 cells per well in V-bottom 96-well low-cell-binding plates (Greiner Bio-One) in DB27 medium (DMEM/F12 HEPES ...
-
bioRxiv - Neuroscience 2022Quote: ... Thirty microliters of 1 μM human PrP23–111 (10 mM sodium carbonate, pH 9.6) was bound to high binding 384-well white plates (Greiner #G781074) with shaking at 400 RPM for 1 h at 37 °C ...
-
bioRxiv - Microbiology 2024Quote: ... at an excitation wavelength of 488 nm and an emission wavelength of 675 nm (50 nm bandwidth) and Black 1536-well flat bottom small volume microplates with a non-binding surface from Greiner Bio-One GmbH (Frickenhausen ...
-
bioRxiv - Microbiology 2024Quote: ... virus solutions were manually mixed immediately prior to deposition of 1 μL droplets on open 96-well plates (non-binding microplates, flat-bottom, transparent, Greiner Bio-One ...
-
bioRxiv - Immunology 2024Quote: ... BLI assays to detect tyrosine sulfation by binding antibodies with anti-sulfotyrosine antibodies were performed using polypropylene black 384-well microplate (Greiner) at 30°C in octet buffer (0.05% Tween in PBS) ...
-
bioRxiv - Cell Biology 2020Quote: ... supplied with 1ml in-house-generated granulocyte-macrophage colony stimulating factor (GM-CSF) into 94mm petri dishes (Greiner, 632180). At day 3 ...
-
bioRxiv - Microbiology 2022Quote: ... Growth took place in 96-well cell culture plates (F-bottom; Greiner Bio-One, Fischer Scientific, US) with 200 μL working volume in thermostated plate-shakers at 30 °C and 600 rpm (PST-60HL ...
-
bioRxiv - Molecular Biology 2020Quote: ... Two μL of antibody diluted in PBS (pH 7.4) was coated on a high-binding 96-well polystyrene microplate (Greiner Bio-One) with 100 μL per well and incubated overnight at room temperature (RT) ...
-
bioRxiv - Cancer Biology 2021Quote: The assays were performed at room temperature using assay buffer (PBS, pH 7.4, 0.01% v/v Tween 20) and black 384-well non-binding polystyrene microplate (Greiner Bio-one, #784900). The peptide of interest was first diluted (10-point ...
-
bioRxiv - Molecular Biology 2022Quote: ... The assay samples (total volume 100 μL) were mixed in a black non-binding 96-well plate (Greiner Bio-One, Switzerland). The plate was sealed (Nunc™ ...
-
bioRxiv - Biochemistry 2021Quote: Measurements were taken in a 96-well black plate (Microplate 96 Well PS F-Bottom Black Non-Binding, Greiner Bio-one) using a TECAN M1000 Pro ...
-
bioRxiv - Bioengineering 2023Quote: ... All binding assays were performed with six replicates and carried out in 0.2 mL 96-well round bottom microplates (Greiner Bio-One) with crystalline cellulose (Avicel PH-101 ...
-
bioRxiv - Microbiology 2020Quote: ... histolytica trophozoites maintained in the logarithmic phase of growth were seeded into 96-well plates (Greiner Bio-One) at 5,000 cells/well to a total volume of 100 μl/well ...
-
bioRxiv - Biochemistry 2022Quote: ... were seeded in a 6-cm culture dish (Greiner Bio-One) at a concentration of 2 x 105 cells per ml (4 ml per dish hereafter ...
-
bioRxiv - Immunology 2019Quote: For WB experiments cells were seeded in 6-well plates (Greiner) at a density of 2·106 cells/well the day before the infection ...
-
bioRxiv - Microbiology 2020Quote: ... Cells were plated in 6-well tissue culture treated plates (Greiner) at 1.75 × 106 cell/ well and allowed to rest overnight ...
-
bioRxiv - Microbiology 2020Quote: ... Cells were plated in 6-well tissue culture treated plates (Greiner) at 1.75 × 106 cell/ well and allowed to rest overnight ...
-
bioRxiv - Microbiology 2021Quote: ... BHK-21 cells grown in 6-well plates (Greiner Bio-One) were infected with 250 μl of the diluted virus for 1 h at room temperature ...
-
bioRxiv - Cancer Biology 2021Quote: Transwell inserts (6-well with 8 µm pores) (Greiner Bio-one) were evenly coated with 75 µL of a 1 mg/mL collagen solution composed of 3 mg/mL rat tail collagen (Gibco) ...
-
bioRxiv - Immunology 2020Quote: HEK-293T cells were plated in a 6-well plate (Greiner) at an initial density of 0.5 x 106 cells per well ...
-
bioRxiv - Biochemistry 2021Quote: ... were seeded in a 6-well culture plate (Greiner Bio-One) at a concentration of 2 × 105 cells ml−1 (2 ml per dish hereafter ...
-
bioRxiv - Biophysics 2022Quote: ... were seeded in a 6-well culture plate (Greiner Bio-One) at a concentration of 2×105 cells/ml (2 mL per well hereafter ...
-
bioRxiv - Microbiology 2020Quote: Cells were plated in 6-well tissue culture treated plates (Greiner) at 1.75 × 106 cell/ well and allowed to rest overnight ...
-
bioRxiv - Biochemistry 2019Quote: ... The insert for 6-well plate (Greiner Bio-One, Frickenhausen, Germany) used to separate the AtT20 and Y-1 cells had a diameter of 23.1 mm ...
-
bioRxiv - Microbiology 2021Quote: MDCK cells were plated in 6-well plates (Greiner Bio-One) and incubated overnight at 37°C with 5% CO2 ...
-
bioRxiv - Neuroscience 2023Quote: Primary mouse cortical neurons were seeded in 6 well plates (Greiner) at a density of 2*106 per well and maintained in NB+B27+PSG as described above ...
-
bioRxiv - Neuroscience 2023Quote: Primary mouse cortical neurons were seeded in 6 well plates (Greiner) at a density of 2*106 cells per well ...
-
bioRxiv - Cell Biology 2023Quote: ... The plastic frame of a 6 wells bottom-less plate (Greiner Bio-One ...
-
bioRxiv - Neuroscience 2023Quote: Primary mouse cortical neurons were seeded in 6 well plates (Greiner) at a density of 2*106 per well and maintained in NB+B27+PSG as described above ...
-
bioRxiv - Cell Biology 2023Quote: ... iPSCs were cultured on a previously coated 6-well plate (Greiner) with 10 ug/ml vitronectin (Stem cell Technologies) ...
-
bioRxiv - Bioengineering 2024Quote: ... and re-seeded onto Geltrex-coated 6-well plates (Greiner, #657160) at a ratio of 1:6 to 1:8 ...
-
bioRxiv - Genetics 2024Quote: ... pellets were transferred to 6 cm non-adherent culture dishes (Greiner) with 15 – 20 pellets per dish in 5 mL of APEL2/PFHM II medium lacking FGF2 with orbital rotation at 60 rpm ...
-
bioRxiv - Molecular Biology 2022Quote: ... 100µl of inactivated FMDV (10µg/ml) in PBS were coated in 96-well ELISA Maxisorp plates (Greiner, Germany), followed by overnight incubation at 37°C ...
-
bioRxiv - Biochemistry 2022Quote: ... Initial assay development was performed in 384-well Lumitrac plates (White, flat bottom, medium binding, Cat# 781075, Greiner Bio-One, Monroe, NC). HTS assays were done in Aurora 1536 plates (white ...
-
bioRxiv - Microbiology 2022Quote: ... and 100 μl was added to the wells of a 96-well MICROLON 200 medium binding plate (Greiner Bio-One, Kremsmünster, Austria). For LPS samples ...
-
bioRxiv - Cell Biology 2019Quote: ... 50 mM Tris·HCl pH 7.4 and 1 mM DTT in a 20 µl volume in non-binding clear bottom 384 well plates (Greiner Bio-One, 781906). Compounds ...
-
bioRxiv - Molecular Biology 2021Quote: ... re-suspended in 25 μl HBSS and then transferred to a previously blocked well of an opaque 96 well high-binding plate (Greiner Bio-One). Chemiluminescence was detected in HBSS using 83.3 μM luminol and 1.5 x 105 PMNs at 37°C for 1 h to characterize the PMN response ...
-
bioRxiv - Immunology 2024Quote: ... A portion of 4 μl per well of this mixture was distributed in white low-volume medium-binding HTRF-adapted 384-well assay plates (784075, Greiner Bio-One). This was followed by the addition of the samples (tissue culture supernatants ...
-
bioRxiv - Microbiology 2024Quote: ... in-house purified KL64 capsule and O2a and O1 O-antigens were used to coat high-binding 384-well plates (Greiner ref. 781061) and incubated at 4°C ON ...
-
bioRxiv - Biophysics 2023Quote: ... Then the solutions were mixed and loaded 100 µL in a 96 well plate (microplate, PS, half area, µClear, Med. binding, Black, Greiner Bio-one). The spectra were recorded from 425 nm to 650nm (10 nm bandwidth ...
-
bioRxiv - Immunology 2024Quote: ... 2-fold serial dilutions were prepared in PBS-T plus 1% BSA in non-binding 96-well plates (Greiner Bio-One, #655901) in triplicate at a starting dilution of 1:50 and a final volume of 60 μL/well ...
-
bioRxiv - Microbiology 2019Quote: ... Nearly all fitness assays were performed in 1.2 mL of growth medium in either a 24-well transparent microplate (Greiner) or in a 96-deepwell plate (Costar) ...
-
bioRxiv - Cell Biology 2023Quote: IMR32 cells were plated in 40 μL of growth medium (5000 cells/well) in white 384-well plates (Greiner). The next day each well was transfected with 100 ng pTI-ARE-LUC using FuGENE HD (4 μL per ug DNA ...
-
bioRxiv - Systems Biology 2022Quote: The signaling response measurements were performed using 6-well plates (Greiner 657165). 300K cells per well were plated and incubated for approximately 24 hours to allow attachment to the plate ...
-
bioRxiv - Molecular Biology 2021Quote: BV2 cells were cultured in 6-well plate (Greiner Bio #657 160). Upon reaching 80% confluency ...