-
No products found
because this supplier's products are not listed.
Quote:
... The human embryonic kidney (HEK)-293T (HEK-293 cells expressing the large T-antigen of simian virus 40) cell line was cultured in complete DMEM medium (Sigma-Aldrich, Zwijndrecht, The Netherlands) containing 10% fetal calf serum (Gibco ...
-
No products found
because this supplier's products are not listed.
María Eugenia Loureiro, et al.,
bioRxiv - Microbiology 2017
Quote:
... 0.1 μg of a mammalian expression vector encoding Cypridina noctiluca luciferase (Cluc) under the control of the constitutively active simian virus 40 (SV40) promoter (pSV40-Cluc; New England BioLabs), were included in the transfection mix ...
-
No products found
because this supplier's products are not listed.
Sabriya A. Syed, et al.,
bioRxiv - Molecular Biology 2018
Quote:
... Homozygous H-2Kb-tsA58 transgenic mice (Immortomice® CBA;B10-Tg(H2Kb-tsA58)6Kio/Crl) harboring the temperature-sensitive simian virus 40 tsA58 mutant large T antigen (tsTAg) were from Charles River Laboratories (Wilmington ...
-
No products found
because this supplier's products are not listed.
Siyu Wei, et al.,
bioRxiv - Biophysics 2018
Quote:
... Anti-Cx43 rabbit polyclonal amino-terminal (Abgent, #AP1541b) and mouse monoclonal carboxyl-terminal (ThermoFisher #35-5000) antibodies were diluted 1:200 in 2% goat serum ...
-
No products found
because this supplier's products are not listed.
Quote:
... A plasmid containing the Renilla luciferase gene behind the simian virus 40 early promoter (pRL) was supplied by Promega Ltd.
-
No products found
because this supplier's products are not listed.
Quote:
... was raised against a synthetic C-terminal peptide (peptide synthesis (CYATNAPPITDIWGD, terminal modification: amidation (C-terminal) and conjugation to KLH) and immunizations performed by GenScript) ...
-
No products found
because this supplier's products are not listed.
Quote:
... The PresentER plasmid encoding a signal peptide from Mouse Mammary Tumor Virus envelope protein followed by the SIINFEKL epitope followed by mCherry was obtained from Addgene (#102945),a kind gift of D ...
-
No products found
because this supplier's products are not listed.
Gretchen Harms Pritchard, et al.,
bioRxiv - Immunology 2019
Quote:
Purified recombinant His-tagged C-terminal MSP1 protein (amino acids 4960 to 5301) (Ndungu et al., 2009) was biotinylated and tetramerized with streptavidin-PE (Prozyme), as previously described (Krishnamurty et al. ...
-
No products found
because this supplier's products are not listed.
Shawn A. Hallett, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... tetracycline-controlled transactivator (tTA) and the SV40 large T antigen polyadenylation signal (Takara Bio, Mountain View, CA), into B6SJLF1 fertilized eggs ...
-
No products found
because this supplier's products are not listed.
Samantha K. Murphy, Michelle M. Arnold,
bioRxiv - Microbiology 2019
Quote:
... Simian MA104 cells were cultured in Medium 199 (M199; Corning) supplemented with 5% FBS ...
-
No products found
because this supplier's products are not listed.
Quote:
... 26.88 units/μL terminal transferase (Roche)] into 20 μL of extracted cDNA using a pipette at 0°C ...
-
No products found
because this supplier's products are not listed.
Quote:
... the tumor cell suspensions were passed through a 40 µm filter (BD) into a clean 50 ml tube ...
-
No products found
because this supplier's products are not listed.
Clara Daher, et al.,
bioRxiv - Immunology 2018
Quote:
... cell suspensions from vaccinated TC1 tumor-bearing mice were resuspended in 40% Percoll (GE Healthcare) layered on top of 80% Percoll ...
-
No products found
because this supplier's products are not listed.
Quote:
... sequences [SLA (p1-p53)] or 0.6 nmol/mL PepTivatorR Candida albicans MP65 (peptides pools of 15 amino acids length with 11 amino acid overlap, Miltenyi Biotec) in 5% human serum RPMI medium in the presence of 1µg/ml anti-CD40 (HB14 ...
-
No products found
because this supplier's products are not listed.
Quote:
RNA was isolated from tumors or tumor cells using RNeasy columns (Qiagen). For TAM sequencing ...
-
No products found
because this supplier's products are not listed.
Quote:
... Antigen retrieval was performed using Antigen Unmasking Solution (Vector Laboratories) at 80°C for 30 minutes ...
-
No products found
because this supplier's products are not listed.
David R. Martinez, et al.,
bioRxiv - Microbiology 2018
Quote:
... Hepatitis B surface antigen (Abcam), and Respiratory syncytial virus (RSV ...
-
No products found
because this supplier's products are not listed.
Quote:
Gam1 carries a single (10 amino acid) N-terminal myc tag that was detected using c-myc antibody (sc-40, Santa Cruz Biotechnology) at 1:500 dilution ...
-
No products found
because this supplier's products are not listed.
Quote:
... The FBXL19 peptide antigen was coupled to Affigel 10 resin (BioRad) and the antibody was affinity-purified and concentrated.
-
No products found
because this supplier's products are not listed.
Quote:
... and its control Tat-GluA23A peptide L-amino acid sequence (YGRKKRRQRRRAKEGANVAG; AnaSpec), were both dissolved in PBS (GluA23Y or GluA23A ...
-
No products found
because this supplier's products are not listed.
Quote:
... vannamei AMPs ALF1 (accession No. AVP74301) and LYZ1 (ABD65298) without N-terminal signal peptide were cloned into pET-32a (+) plasmid (Merck Millipore, Germany) specific primers (Supplement Table 1) ...
-
No products found
because this supplier's products are not listed.
Z. Lu, et al.,
bioRxiv - Biochemistry 2018
Quote:
... followed by a C-terminal tag SASTSHHHHHH was produced using baculo-virus mediated overexpression in HighFive cells with Insect-XPRESS+L-Glutamine medium (Lonza). Briefly ...
-
No products found
because this supplier's products are not listed.
Xiaosheng Wu, et al.,
bioRxiv - Cancer Biology 2018
Quote:
... tumor cells were incubated in Fixation Buffer (BioLegend) for 20 min at room temperature ...
-
No products found
because this supplier's products are not listed.
Quote:
... GST-Aq-NF-κB or GST-Aq-NF-κB-ALA C-terminal peptides and 5 μCi [γ-32P] ATP (Perkin Elmer) in kinase reaction buffer (25 mM Tris-HCl ...
-
No products found
because this supplier's products are not listed.
Quote:
... Large fragments were removed using 0.4 × AMPure beads (Beckman Coulter). Libraries were sequenced on NextSeq 500.
-
No products found
because this supplier's products are not listed.
Quote:
... and probed with either an affinity-purified antibody fraction of mouse antiserum to a synthetic peptide of human cystatin-s corresponding to amino acid residues 21-141 (AF1296, R&D Systems) or an affinity-purified goat antibody raised against a peptide mapping at the C-terminus of human amylase (sc-12821 ...
-
No products found
because this supplier's products are not listed.
Quote:
Frozen tumors were thin sectioned (7 μm) using a cryostat (Leica), mounted onto glass slides ...
-
No products found
because this supplier's products are not listed.
Quote:
KANK peptides with a C-terminal cysteine residue were synthesized by Biomatik (USA): KANK1(30–60)C-PYFVETPYGFQLDLDFVKYVDDIQKGNTIKKC KANK1(30–68)C-PYFVETPYGF QLDLDFVKYVDDIQKGNTIKKLNIQKRRKC KANK1-4A-PYFVETPYGFQAAAAFVKYVDDIQKGNTIKKLNIQKRRKC KANK2(31–61)C-PYSVETPYGYRLDLDFLKYVDDIEKGHTLRRC
-
No products found
because this supplier's products are not listed.
Yuki Kambe, et al.,
bioRxiv - Neuroscience 2018
Quote:
PACAP (38 amino acid form) and VIP were purchased from Peptide Institute Inc ...
-
No products found
because this supplier's products are not listed.
Jia Zhao, et al.,
bioRxiv - Developmental Biology 2017
Quote:
... or 20 VIVIT peptide (Tocris) was used to activate or inhibit NFAT ...
-
No products found
because this supplier's products are not listed.
Quote:
... Image acquisition and stitching of a large field of 7×7 mm with 40% overlap was handled by Nikon NIS-Elements AR 4.0 software ...
-
No products found
because this supplier's products are not listed.
Quote:
... and monomethyl arginine peptides were immunoprecipitated by addition of 40 uL of PTMScan Symmetric Di-Methyl Arginine Motif Kit (13563, Cell Signaling), PTMScan Asymmetric Di-Methyl Arginine Motif Kit (13474 ...
-
No products found
because this supplier's products are not listed.
Miao-Ping Chien, et al.,
bioRxiv - Neuroscience 2017
Quote:
Imaging was performed with a large dissecting microscope objective (MV PLAPO 2x 0.5 NA; Olympus). Fluorescence was separated from illumination light using an emission filter (Semrock #Em01-R405/488/635) ...
-
No products found
because this supplier's products are not listed.
Junzuo Liao, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... large tumor suppressor kinase 1 (LATS1) (1:300, Proteintech), phosphorylated (p)-YAP (1:1,000 ...
-
No products found
because this supplier's products are not listed.
Raquel Santana da Cruz, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... Antigen retrieval was performed by immersing the tissue sections at 98°C for 40 minutes in 1X Diva Decloaker (Biocare). Tissue sections were treated with 3% hydrogen peroxide and 10% normal goat serum for 10 minutes ...
-
No products found
because this supplier's products are not listed.
Quote:
... each mouse was immunized with 200 μl of antigen/adjuvant mix containing 50 μg of antigen and 100 μl AddaVax adjuvant (Invivogen) or 50 μl PIKA adjuvant (Yisheng Biopharma ...
-
No products found
because this supplier's products are not listed.
Quote:
... For tumor cells (sequenced by Illumina HiSeq 2500), genes with detected expression in at least 5 cells were included and cells with either less than 600 genes and 1500 UMI or more than 4000 genes and 20000 UMI were excluded ...
-
No products found
because this supplier's products are not listed.
Androniqi Qifti, et al.,
bioRxiv - Biochemistry 2019
Quote:
... 1% non-essential amino acids (VWR) and 1% L-glutamine (VWR) ...
-
No products found
because this supplier's products are not listed.
Quote:
Peptides were identified using ProteinPilot 4.1 (SCIEX), searching the LudwigNR database (downloaded from http://apcf.edu.au as at 27 January 2012 ...
-
No products found
because this supplier's products are not listed.
Quote:
One female day 70 mouse of the Mouse Mammary Tumor Virus-Polyoma Middle T Antigen strain (MMTV-PyMT, Jackson Laboratories) was sacrificed and the largest mammary tumor from each inguinal mammary gland was surgically excised ...
-
No products found
because this supplier's products are not listed.
Alexandre Pellan Cheng, et al.,
bioRxiv - Genomics 2019
Quote:
... and SV40 large T antigen of the BK virus (Affinity purified and agarose conjugated IgG2A mouse monoclonal antibody recognizing the 94kDa SV40 large T antigen; PAb416, Cat. No. DPO2, Calbiochem, USA) respectively.
-
No products found
because this supplier's products are not listed.
Quote:
... peptides corresponding to the amino-terminal region and internal region of the Gβ13F protein were commercially synthesized and used to immunize rabbits (Eurogentec). The peptide sequences employed were as follows ...
-
No products found
because this supplier's products are not listed.
Quote:
... A small volume (20 – 40 nl) of virus was injected (WTB and KAE: Nanoject II, Drummond Scientific, Broomall ...
-
No products found
because this supplier's products are not listed.
Paola Munoz-Tello, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... using a pET-46 tobacco etch virus (TEV) protease-cleavable N-terminal hexahistidine tag fusion protein in M9 media supplemented with 15NH4Cl (Cambridge Isotope Labs, Inc.). Nurr1 LBD was eluted against a 500 mM imidazole gradient through a Ni-NTA column ...
-
No products found
because this supplier's products are not listed.
Quote:
... The peptide sequences were synthesized in situ with a Roche Sequencing Solutions Maskless Array Synthesizer (MAS) by light-directed solid-phase peptide synthesis using an amino-functionalized plastic support (Greiner Bio-One, Kremsmünster, Austria) coupled with a 6-aminohexanoic acid linker and amino acid derivatives carrying a photosensitive 2-(2-nitrophenyl ...
-
No products found
because this supplier's products are not listed.
Quote:
... or the Zymoclean Large Fragment DNA Recovery Kit (Zymo Research, Irvine CA). Purified DNA fragments were ligated overnight at 4°C with T4 DNA ligase (New England Biolabs ...
-
No products found
because this supplier's products are not listed.
Quote:
... Dengue virus NS2B (Genetex, GTX124246) at 1:1000 ...
-
No products found
because this supplier's products are not listed.
Miguel O. Bernabeu, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Tumor images were acquired with Zeiss LSM 880 microscope (Carl Zeiss AG), connected to a Mai-Tai tunable laser (Newport Spectra Physics) ...
-
No products found
because this supplier's products are not listed.
Quote:
... 40 ng/ml SCF (PeproTech), and 10 ng/ml TPO (PeproTech).
-
No products found
because this supplier's products are not listed.
Quote:
Amino acids analysis was conducted on LC/MS/MS system according to EZ:faast protocol for free amino acids (Phenomenex, Torrance, CA, USA). The EZ:faast kit contains standard solutions ...