1 - 50 of 372
suppliers found for
mu p75 SAP Kit
» view 10000+ matched products-
Advanced Targeting Systems Sponsored
mu p75-SAP is a chemical conjugate of the affinity-purified rabbit polyclonal antibody p75NTR...Cat# IT-16-1000, 1.0 milligram, USD $14850.0 Ask
-
Millipore Sigma
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2020Quote: ... p75 NTR (Millipore, rabbit 1:1000), serine 63 phosphorylated c-Jun (Cell Signaling Technology ... -
Thermo Fisher
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2022Quote: ... 0.5 µl of SAP (Affymetrix), 0.1 µl E ... -
New England Biolabs
No products found because this supplier's products are not listed.bioRxiv - Genomics 2021Quote: ... and SAP (NEB, M0371S) treatment ... -
Advanced Targeting Systems
mu p75-SAP is a chemical conjugate of the affinity-purified rabbit polyclonal antibody p75NTR...Cat# IT-16-1000, 1.0 milligram, USD $14850.0 AskbioRxiv - Neuroscience 2021Quote: ... anti-p75 conjugated saporin (p75-saporin) or IgG-saporin control (n = 8 / group, Advanced Targeting Systems) was diluted to final concentration of 0.4 mg/ml in normal saline ... -
Roche
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2020Quote: ... 14 mU of Arthrobacter ureafaciens NA (Roche) was incubated with the infected cell pellet at room temperature for 1 h prior to treatment with deoxycholate. -
abcam
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2021Quote: ... P75 (Abcam, 1:50), DST (Affinity Biosciences ... -
Promega
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2018, published in Journal of Tissue Engineering and Regenerative Medicine doi: 10.1002/term.2840Quote: ... and incubated overnight at 4° C with rabbit anti-rat p75 neurotrophin receptor (p75(NTR) (Promega, 1:500) in PBS with 1% BSA ... -
BioLegend
No products found because this supplier's products are not listed.bioRxiv - Physiology 2019, published in eLife doi: 10.7554/eLife.52539Quote: ... anti-SAP (Rat, 1A9, Biolegend), anti-β actin (Mouse ... -
Addgene
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2020Quote: ... Mu-BsaI transposon was digested from pUC-KanR-Mu-BsaI (Addgene plasmid # 79769) with BglII and HindIII in Buffer 3.1 (NEB ... -
Seikagaku
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2020Quote: ... heparitinase I at 10 mU/mL (Seikagaku, 100704), chondroitinase ABC at 100 mU/mL (Sigma Aldrich ... -
Agilent
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2019, published in Aging doi: 10.18632/aging.103884Quote: ... and 1.25 mU of PNGase F (ProZyme) were added to each sample and incubated overnight at 37 °C ... -
Merck
No products found because this supplier's products are not listed.bioRxiv - Plant Biology 2021Quote: Xylem sap ammonium and nitrate concentrations were determined with Spectroquant® kits for ammonium or nitrate (Merck KGaA) spectrophotometric analyses according to the instructions of the manufacturer using 100 μl xylem sap ... -
Takara Bio
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2021Quote: ... and 10 μL (1 mU) of Pfu PGAP (TaKaRa) was added ... -
R&D Systems
No products found because this supplier's products are not listed.bioRxiv - Pharmacology and Toxicology 2021Quote: ... 10 mU recombinant DPP-4 (R&D Systems), or no enzyme as a control for non-enzymatic degradation over the same time period ... -
Becton, Dickinson and Company
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2020Quote: ... Monoclonal Anti LEDGF/p75 was purchased from BDbiosciences (ref 61175 (1/600)) ... -
Qiagen
No products found because this supplier's products are not listed.bioRxiv - Immunology 2020Quote: ... SHP1 and SAP were purchased from QIAGEN (Hilden, Germany) (siSLAMF6(1 ... -
GE Life Sciences
No products found because this supplier's products are not listed.bioRxiv - Genetics 2019, published in PLOS ONE doi: 10.1371/journal.pone.0220539Quote: ... The amplicons were purified using ExoI-SAP (GE Healthcare) and directly sequenced in a MegaBACETM500 (GE Healthcare) ... -
Neuromics
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2020Quote: ... goat anti-p75 (Neuromics #GT15057; 1:400), rabbit anti-Ki67 (Abcam #ab15580 ... -
Evrogen
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ... -
PerkinElmer
No products found because this supplier's products are not listed.bioRxiv - Plant Biology 2021Quote: ... The product 4-methylumbelliferon (MU) was quantified using a fluorimeter (Perkin Elmer LS55, USA). Protein concentration was determined by Bradford assay (Bio-Rad ... -
Vector Labs
No products found because this supplier's products are not listed.bioRxiv - Pathology 2018, published in PLOS Neglected Tropical Diseases doi: 10.1371/journal.pntd.0007054Quote: ... mu chain specific (1:500 dilution, Vector Laboratories, Burlingame, CA), was added to the wells and incubated for 30 minutes in a humidified chamber ... -
Bio-Rad
No products found because this supplier's products are not listed.bioRxiv - Molecular Biology 2021Quote: ... Tables S1 and S3) and their CWD status was independently identified utilizing the Bio-Rad TeSeE Short Assay Protocol (SAP) Combo Kit (BioRad Laboratories Inc., Hercules, CA, USA). Positive RPLNs were confirmed by IHC at the Colorado State University Veterinary Diagnostic Laboratory (CSU VDL) ... -
Illumina
No products found because this supplier's products are not listed.bioRxiv - Evolutionary Biology 2020Quote: ... and converted to cDNA) was sequenced in CEITEC MU Genomics Core Facility on a NextSeq500 platform (Illumina®) using NextSeq 500 v2.5. ... -
Jena Bioscience
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2019, published in International Journal for Parasitology: Parasites and Wildlife doi: 10.1016/j.ijppaw.2019.07.004Quote: All PCR products with the expected size were purified using the SAP-Exo Kit (Jena Bioscience GmbH, Jena, Germany) and Sanger sequenced from both directions by LGC Genomics (Berlin ... -
Calbiochem
No products found because this supplier's products are not listed.bioRxiv - Systems Biology 2019, published in PLOS Computational Biology doi: 10.1371/journal.pcbi.1007702Quote: ... Donor cells were treated with both neuraminidase (Calbiochem, 66 mU/ml) and chymotrypsin (Worthington Biochemicals ... -
Lonza
No products found because this supplier's products are not listed.Cited in Mesoscale Dynamics of Spectrin and Acto-Myosin shape Membrane Territories during MechanoresponsebioRxiv - Cell Biology 2019Quote: Immortalized mouse embryonic fibroblasts (MEFs) derived from RPTP α+/+ murine background (Su, Muranjan and Sap, 1999) were grown in complete media composed by DMEM (Lonza) supplemented with 10% Fetal Bovine Serum South American (FBS SA ... -
Stemcell Technologies
No products found because this supplier's products are not listed.bioRxiv - Developmental Biology 2018, published in eLife doi: 10.7554/eLife.35786Quote: ... For further sympathetic neuron differentiation d12 SAP cells were switched into a medium containing BrainPhys neuronal medium (Stem Cell Technologies), 1× B27 supplement (Thermo Fisher) ... -
Zymo Research
No products found because this supplier's products are not listed.Cited in SABER enables highly multiplexed and amplified detection of DNA and RNA in cells and tissuesbioRxiv - Genetics 2018, published in Nature Methods doi: 10.1038/s41592-019-0404-0Quote: ... kit or DNA Clean and Concentrator kit (Zymo, DCC-100) with distilled water elution to reduce volume and salt concentration from the reaction condition ... -
Bethyl
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2022Quote: The following primary antibodies were used: rabbit polyclonal anti-LEDGF/p75 (Bethyl Laboratories; product code A300-848A), rabbit polyclonal anti-HRP2 (Novus Bio ... -
Eppendorf
No products found because this supplier's products are not listed.bioRxiv - Plant Biology 2021Quote: ... 50 μl unprocessed xylem sap were transferred to a 2 mL reaction tube (Eppendorf) and 200 μL extraction medium (methanol ... -
Biotek
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2018, published in The Journal of Cell Biology doi: 10.1083/jcb.201805100Quote: ... Liberated 4-methylumbelliferone (4-MU) was measured with a Synergy 4 microplate reader (BioTek) at an excitation wavelength of 360 nm and an emission wavelength of 450 nm ... -
Cell Signaling Technology
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2020Quote: ... After this anti-rabbit IgG secondary antibody (for Sap and EA1) or anti-mouse IgG secondary antibody (for BslO) conjugated with horseradish peroxide (1:10,000 - Cell Signaling Technology) was used and the blots were incubated for another 60 min ... -
Miltenyi Biotec
No products found because this supplier's products are not listed.bioRxiv - Immunology 2020Quote: ... following manufacturer instructions (Dead cell removal kit; Debris removal kit; Miltenyi Biotec) resulting in ~80% of purity and CD3+ T cells were resuspended in 1X PBS with 0.04% BSA ... -
Omega Bio-Tek
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2020Quote: ... gel extraction kit and DNA purification kit were obtained from Omega Bio-tek, Inc ... -
Macherey-Nagel GmbH
No products found because this supplier's products are not listed.bioRxiv - Immunology 2021Quote: ... a NucleoSpin kit (Macherey-Nagel) was used ... -
NanoTemper
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2020Quote: ... histidine tagged HMGB1 was labeled by the his-tag specific NT-647 dye (Monolith NTTM Protein Labelling Kit RED-NHS, NanoTemper® Technologies GmbH, Mu□nchen, Germany), for 30 minutes at room temperature ... -
Corning
No products found because this supplier's products are not listed.bioRxiv - Pathology 2018Quote: ... The filtered sap inoculum was then added to adherent leafhopper cell cultures at 1 mL per 25 cm2 flask (Corning®, Inc), and let stand for 10 minutes ... -
Lucigen
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2018, published in Proceedings of the National Academy of Sciences doi: 10.1073/pnas.1820256116Quote: ... DNA isolation kits were purchased from Lucigen (Masterpure Gram Positive kit) and Qiagen (QIAprep Spin Miniprep Kit) ... -
TianGen Biotech
No products found because this supplier's products are not listed.bioRxiv - Bioengineering 2017, published in Frontiers in Plant Science doi: 10.3389/fpls.2018.00554Quote: ... RNA extraction kit and qRT-PCR kit were purchased from Tiangen Company ... -
Bioline
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2019Quote: ... using the amplification kit SensiFAST SYBR No-Rox kit (Bioline, London, UK), according to the manufacturer’s instructions ... -
Biovision
No products found because this supplier's products are not listed.bioRxiv - Plant Biology 2019Quote: Bulk methyl and O-acetyl ester content of AIR samples was carried out using commercial kits (Methanol Assay Kit, and Acetate Assay Kit, BioVision, CA, USA). AIR samples (2.5 mg ... -
Beckman
No products found because this supplier's products are not listed.bioRxiv - Developmental Biology 2021Quote: AnnexinV/FITC Kit (Beckman Coulter) was used to quantify apoptosis in mouse sperm ... -
Sartorius
No products found because this supplier's products are not listed.bioRxiv - Genetics 2020Quote: ... The xylem sap was filtered through Vivaspin 15R centrifugal concentrators (Sartorius) and directly used as medium for inoculation. -
Santa Cruz
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2019, published in Journal of Cell Biology doi: 10.1083/jcb.201905085Quote: ... SAP monoclonal antibody (#sc-393948) and GRB2 monoclonal antibody (#sc-8034) were obtained from Santa Cruz Biotechnology ... -
VWR
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2020Quote: ... All PKC assays (except the PKC-mu and the PKC-nu assay) additionally contained 1 mM CaCl2 (VWR; Cat. # 1.02382), 4 mM EDTA (Roth ... -
Molecular Devices
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2018Quote: ... Stop buffer pH 10.7 was added and the released 4-MU fluorophore was quantified using a Gemini XPS Spectrometer (Molecular Devices, Sunnyvale, CA, USA) (excitation length ... -
Diagenode
No products found because this supplier's products are not listed.bioRxiv - Genomics 2019, published in PLOS ONE doi: 10.1371/journal.pone.0214559Quote: ... MethylCap kit (Diagenode, C02020010) was employed to obtain the methylated DNA ... -
Active Motif
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2019Quote: ChIP assays were performed with a commercial kit (Chip-IT kit, Active motif). The cortices from P2 wildtype mice were minced and crosslinked in 1% formaldehyde (F8775 ... -
Cayman Chemical
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2021Quote: ... Serum was stored at -20°C until later assayed for ACTH and CORT using commercially available enzyme-linked immunosorbent assay kits according to the manufacturers’ instructions (ACTH kit: cat# EK-001-21, Phoenix Pharmaceuticals, Burlingame, CA; CORT kit: cat# 501320, Cayman Chemical, Ann Arbor, MI). -
MP Biomedicals
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2018, published in Antimicrobial Agents and Chemotherapy doi: 10.1128/aac.01379-18Quote: Gnome® DNA kit (MP Biomedicals) was used to extract genomic DNA ...