-
No products found
because this supplier's products are not listed.
Laura J. Wagstaff, et al.,
bioRxiv - Neuroscience 2020
Quote:
... p75 NTR (Millipore, rabbit 1:1000), serine 63 phosphorylated c-Jun (Cell Signaling Technology ...
-
No products found
because this supplier's products are not listed.
Xiaoxu Yang, et al.,
bioRxiv - Genomics 2021
Quote:
... and SAP (NEB, M0371S) treatment ...
-
No products found
because this supplier's products are not listed.
Alena Kozlova, et al.,
bioRxiv - Neuroscience 2022
Quote:
... 0.5 µl of SAP (Affymetrix), 0.1 µl E ...
-
Cat# KIT-16-100,
100 micrograms,USD $2250.0
Ask
Lidia I. Madrid, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Infusion of murine-p75 neurotrophin receptor (p75NTR)-Saporin (hereafter abbreviated as p75-Sap; 0.4 µg/µl; Advanced Targeting System) or control rabbit-IgG-Saporin (IgG-Sap ...
-
No products found
because this supplier's products are not listed.
Yanan Yang, et al.,
bioRxiv - Cell Biology 2021
Quote:
... P75 (Abcam, 1:50), DST (Affinity Biosciences ...
-
No products found
because this supplier's products are not listed.
P.A. Goldsteen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... and p75 (Biolegend, 345101) for 60 minutes on ice ...
-
No products found
because this supplier's products are not listed.
André Folgado, Rita Abranches,
bioRxiv - Plant Biology 2021
Quote:
... and endoglycosidase H (2.5 mU) (Roche, USA). Samples were incubated at 37 °C overnight ...
-
No products found
because this supplier's products are not listed.
D. Lapaillerie, et al.,
bioRxiv - Microbiology 2020
Quote:
... Monoclonal Anti LEDGF/p75 was purchased from BDbiosciences (ref 61175 (1/600)) ...
-
No products found
because this supplier's products are not listed.
Karl Kasper, et al.,
bioRxiv - Plant Biology 2021
Quote:
Xylem sap ammonium and nitrate concentrations were determined with Spectroquant® kits for ammonium or nitrate (Merck KGaA) spectrophotometric analyses according to the instructions of the manufacturer using 100 μl xylem sap ...
-
No products found
because this supplier's products are not listed.
Jerko Stambuk, et al.,
bioRxiv - Biochemistry 2019
Quote:
... and 1.25 mU of PNGase F (ProZyme) were added to each sample and incubated overnight at 37 °C ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Phospho-Tyrosine specific antibodies (anti P-Tyr674/675 from Cell Signalling 1:3000) and anti-p75 intracellular antibody (Promega) were used ...
-
No products found
because this supplier's products are not listed.
Emma Hajaj, et al.,
bioRxiv - Immunology 2020
Quote:
... SHP1 and SAP were purchased from QIAGEN (Hilden, Germany) (siSLAMF6(1 ...
-
No products found
because this supplier's products are not listed.
John N. Koberstein, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Mu-BsaI transposon was digested from pUC-KanR-Mu-BsaI (Addgene plasmid # 79769) with BglII and HindIII in Buffer 3.1 (NEB ...
-
No products found
because this supplier's products are not listed.
Yutaka Sakamaki, et al.,
bioRxiv - Synthetic Biology 2022
Quote:
... After digestion by BamHI and dephosphorylation treatment using SAP (TaKaRa), the DNA fragment was ligated with 1.5-2.5 kbp fragments of the Sau3AI-digested S ...
-
No products found
because this supplier's products are not listed.
Juliana Cordeiro, et al.,
bioRxiv - Genetics 2019
Quote:
... The amplicons were purified using ExoI-SAP (GE Healthcare) and directly sequenced in a MegaBACETM500 (GE Healthcare) ...
-
No products found
because this supplier's products are not listed.
Phil Pickford, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... 10 mU recombinant DPP-4 (R&D Systems), or no enzyme as a control for non-enzymatic degradation over the same time period ...
-
No products found
because this supplier's products are not listed.
Zhouyi Rong, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Mouse Interferon Gamma (IFNg) ELISA Kit (RD-IFNg-Mu, Reddot biotech), Mouse Interleukin 6 (IL6 ...
-
No products found
because this supplier's products are not listed.
Christine Chiasson-MacKenzie, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... anti-p75 NTR rabbit mAb (1:1000; D8A8, Cell Signaling Technology); anti-N-cadherin mouse mAb (1:500 ...
-
No products found
because this supplier's products are not listed.
Gage R. Rowden, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... ELISAs were performed with the Bio-Rad TeSeE Short Assay Protocol (SAP) Combo Kit (BioRad Laboratories Inc., Hercules, CA, USA). Importantly ...
-
No products found
because this supplier's products are not listed.
Nadine Nagy, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
4-MU (Alfa Aesar) was pressed into the mouse chow by TestDiet® and irradiated before shipment ...
-
No products found
because this supplier's products are not listed.
Niraj Lodhi, et al.,
bioRxiv - Plant Biology 2021
Quote:
... The product 4-methylumbelliferon (MU) was quantified using a fluorimeter (Perkin Elmer LS55, USA). Protein concentration was determined by Bradford assay (Bio-Rad ...
-
No products found
because this supplier's products are not listed.
Samuel Schmidt, et al.,
bioRxiv - Cell Biology 2020
Quote:
... heparitinase I at 10 mU/mL (Seikagaku, 100704), chondroitinase ABC at 100 mU/mL (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Vratislav Peska, et al.,
bioRxiv - Evolutionary Biology 2020
Quote:
... and converted to cDNA) was sequenced in CEITEC MU Genomics Core Facility on a NextSeq500 platform (Illumina®) using NextSeq 500 v2.5. ...
-
No products found
because this supplier's products are not listed.
Salim Benlefki, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Motoneurons were isolated from the spinal cord of Smn2B/+ and Smn2B/- embryos using 5.2% iodixanol density gradient centrifugation combined with p75-based magnetic cell isolation (Miltenyi Biotec) as we previously described (Soulard et al. ...
-
No products found
because this supplier's products are not listed.
Melissa A. Sleda, et al.,
bioRxiv - Microbiology 2022
Quote:
... Gel extraction kit and DNA purification kit were from Zymo Research ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Andrea Ghisleni, et al.,
bioRxiv - Cell Biology 2019
Quote:
Immortalized mouse embryonic fibroblasts (MEFs) derived from RPTP α+/+ murine background (Su, Muranjan and Sap, 1999) were grown in complete media composed by DMEM (Lonza) supplemented with 10% Fetal Bovine Serum South American (FBS SA ...
-
No products found
because this supplier's products are not listed.
Víctor Hugo Jarquín-Díaz, et al.,
bioRxiv - Microbiology 2019
Quote:
All PCR products with the expected size were purified using the SAP-Exo Kit (Jena Bioscience GmbH, Jena, Germany) and Sanger sequenced from both directions by LGC Genomics (Berlin ...
-
No products found
because this supplier's products are not listed.
Julia Franz, et al.,
bioRxiv - Neuroscience 2022
Quote:
... A mouse-on-mouse kit (MOM Basic Kit; Vector Laboratories) was used for CB ...
-
No products found
because this supplier's products are not listed.
A. M. Hellens, et al.,
bioRxiv - Plant Biology 2023
Quote:
... Mini kit (Macherey-Nagel), or as described in 43 ...
-
No products found
because this supplier's products are not listed.
Iva Kelava, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... We used the commercial kit (STEMdiff™ Cerebral Organoid Kit, StemCell Technologies 08570) with previously described modifications to increase embryoid body surface area75 ...
-
No products found
because this supplier's products are not listed.
Sha Sun, Xia Li, Malaiyalam Mariappan,
bioRxiv - Cell Biology 2022
Quote:
... The released 4-MU was measured by a fluorescence reader (TECAN) using 360nm excitation filter and 465nm emission filter ...
-
No products found
because this supplier's products are not listed.
Antonin Weckel, et al.,
bioRxiv - Microbiology 2019
Quote:
... using the amplification kit SensiFAST SYBR No-Rox kit (Bioline, London, UK), according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Haixia Wang, et al.,
bioRxiv - Microbiology 2020
Quote:
... gel extraction kit and DNA purification kit were obtained from Omega Bio-tek, Inc ...
-
No products found
because this supplier's products are not listed.
Matthew Grove, et al.,
bioRxiv - Neuroscience 2020
Quote:
... goat anti-p75 (Neuromics #GT15057; 1:400), rabbit anti-Ki67 (Abcam #ab15580 ...
-
A component of the Papain Dissociation System, for use in the tissue dissociation method of...
Cat# LK003178,
5 vi, $98.00
Ask
Paulina Valadez-Cosmes, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... and DNase I (160 mU/mL, Worthington; LS002006) in RPMI for 20 min at 37 °C while rotating at 1000 rpm ...
-
No products found
because this supplier's products are not listed.
Honey Bokharaie, Walter Kolch, Aleksandar Krstic,
bioRxiv - Cancer Biology 2022
Quote:
... SF3B1 / SAP 155 (B-3) (1/1000 dilution, #sc-514655, Santa Cruz, Mouse), HSP90 (c45g5 ...
-
No products found
because this supplier's products are not listed.
Francisco Cai, et al.,
bioRxiv - Systems Biology 2019
Quote:
... Donor cells were treated with both neuraminidase (Calbiochem, 66 mU/ml) and chymotrypsin (Worthington Biochemicals ...
-
No products found
because this supplier's products are not listed.
John Lees, et al.,
bioRxiv - Molecular Biology 2023
Quote:
MeDIP-Seq libraries for Ion Torrent semiconductor sequencing were performed on the Ion Torrent PGM using a modified protocol from Ion Plus Fragment Library kit (Catalog # 4471252) combined with a 5-hydroxymethylcytosine (5hmC Kit, Catalog # AF-110–0016) immunoprecipitation kit (Diagenode) according to a previously optimized protocol (Guerrero-Bosagna & Jensen ...
-
No products found
because this supplier's products are not listed.
Shuyi Hou, et al.,
bioRxiv - Microbiology 2020
Quote:
... A kit from Tiangen Biotech (China ...
-
No products found
because this supplier's products are not listed.
Seong-Min Kim, et al.,
bioRxiv - Developmental Biology 2023
Quote:
Glycogen assay kit (BioVision) was used to measure the relative intracellular glycogen amount ...
-
No products found
because this supplier's products are not listed.
Hisashi Ukawa, et al.,
bioRxiv - Genetics 2023
Quote:
... DNA was extracted from oral mucosal tissue using a commercial kit (chemagic™ DNA Buccal Swab Kit, PerkinElmer and DNAdvance Kit, Beckman Coulter). We performed real-time PCR to determine genotypes of DM-associated mutations (SOD1:c.118G
-
No products found
because this supplier's products are not listed.
Sajjad Khani, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Plasmid Safe DNase kit (EpiCentre) was used to degrade any unspecific recombination products for 30 min at 37 °C ...
-
No products found
because this supplier's products are not listed.
Allison Ballandras-Colas, et al.,
bioRxiv - Biochemistry 2022
Quote:
The following primary antibodies were used: rabbit polyclonal anti-LEDGF/p75 (Bethyl Laboratories; product code A300-848A), rabbit polyclonal anti-HRP2 (Novus Bio ...
-
No products found
because this supplier's products are not listed.
Omer Revah, et al.,
bioRxiv - Neuroscience 2024
Quote:
... connected to an MU-type head stage (Molecular Devices, Foster City, CA). Patch pipettes were manufactured from thick-walled borosilicate glass capillaries (outer diameter ...
-
No products found
because this supplier's products are not listed.
Jacopo Sgrignani, et al.,
bioRxiv - Biochemistry 2020
Quote:
... histidine tagged HMGB1 was labeled by the his-tag specific NT-647 dye (Monolith NTTM Protein Labelling Kit RED-NHS, NanoTemper® Technologies GmbH, Mu□nchen, Germany), for 30 minutes at room temperature ...
-
No products found
because this supplier's products are not listed.
Clara Young, et al.,
bioRxiv - Immunology 2024
Quote:
... The heavy immunoglobulin variable region sequences were inserted into the human heavy chain mu constant region secretory sequence (Genbank accession number BC073758.1) and synthesised into mammalian vector pcDNA3.1 (Genscript). Similarly ...
-
No products found
because this supplier's products are not listed.
Rekha Gopalan-Nair, et al.,
bioRxiv - Evolutionary Biology 2023
Quote:
... Using SMRTBell template Prep Kit 1.0 and SMRTbell Barcoded Adaptater kit 8A or 8B kits (PacBio), samples (1 µg ...
-
No products found
because this supplier's products are not listed.
Peixiang Zhang, et al.,
bioRxiv - Physiology 2022
Quote:
... and glutathione levels were assayed using enzymatic kits (Glutamate Assay Kit, Sigma-Aldrich, MAK004-1KT; α-Ketoglutarate Assay Kit, Sigma-Aldrich, MAK054-1KT; Glutathione Assay Kit, Cayman Chemical, #703002) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Mei Zhang, et al.,
bioRxiv - Neuroscience 2019
Quote:
ChIP assays were performed with a commercial kit (Chip-IT kit, Active motif). The cortices from P2 wildtype mice were minced and crosslinked in 1% formaldehyde (F8775 ...