-
No products found
because this supplier's products are not listed.
Lauren T. Que, Marie E. Morrow, Cynthia Wolberger,
bioRxiv - Biochemistry 2019
Quote:
... 5 (LifeSensors) FRET-K48 diubiquitin ...
-
No products found
because this supplier's products are not listed.
H. Dihazi, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Bone Morphogenetic Protein-5 (BMP-5 – 100 ng/mL); melatonin (5 µMol/L) ...
-
No products found
because this supplier's products are not listed.
Kishor Dnyaneshwar Ingole, et al.,
bioRxiv - Plant Biology 2020
Quote:
... The membrane was blocked with 5% non-fat skim milk and western blots performed with indicated primary antibodies [anti-SNC1 (Abiocode), anti-PR1 or anti-PR2 (Agrisera) ...
-
No products found
because this supplier's products are not listed.
Djem U. Kissiov, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... In all cases medium contained 5% FCS (Omega Scientific), 0.2 mg/mL glutamine (Sigma) ...
-
96 well glass bottom plate. Black polystyrene frame with #1 glass(0.13-0.16mm), with lid,...
Cat# P96-1-N,
20/case, $226.00
Ask
Chih-Chia Chang, Scott M. Coyle,
bioRxiv - Synthetic Biology 2023
Quote:
Cells were plated on 0.17±5 μm 24 well glass bottom plate (Cellvis) in the FluotoBriteTM DMEM (ThermoFisher A1896701 ...
-
No products found
because this supplier's products are not listed.
Michele N. Dill, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Incubation with HRP secondary antibodies (Arigo biolaboratories ARG65350 ...
-
siRNA to inhibit ZKSCAN5 expression using RNA interference
Cat# CRM4500,
15 nmol USD $340.0, 30 nmol USD $510.0
Ask
Rafał Zdrzałek, et al.,
bioRxiv - Plant Biology 2020
Quote:
... Respective primary HRP-conjugated antibodies (α-FLAG: Cohesion Biosciences, CPA9020 ...
-
No products found
because this supplier's products are not listed.
Kian Hong Kock, et al.,
bioRxiv - Genetics 2023
Quote:
... At least 3 scans were taken for each slide at different photomultiplier tube (PMT) gain settings.
-
No products found
because this supplier's products are not listed.
Ling Li, et al.,
bioRxiv - Immunology 2023
Quote:
... HRP–conjugated goat anti-human antibodies (Zen-bio, 550004; 1:5000 dilution) were added to the wells and incubated at 37°C for 1hr ...
-
No products found
because this supplier's products are not listed.
A. Perna, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... slides were incubated with UltraTek HRP secondary antibody (ScyTek Laboratories, Logan, Utah, U.S.A.) for 1 hr at room temperature Diamonibenzidine (ScyTek Laboratories ...
-
No products found
because this supplier's products are not listed.
Yara Eid Mutlak, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Phospho-Serine antibody was from ECM biosciences (Cat# PP2551, lot# 5). Anti-Laminin (Cat# L9393 ...
-
No products found
because this supplier's products are not listed.
Priya Crosby, et al.,
bioRxiv - Biochemistry 2023
Quote:
Mouse CRY1 PHR domain (residues 1-491) was expressed in Sf9 suspension insect cells (Expression Systems) as previously described (Parico et al. ...
-
No products found
because this supplier's products are not listed.
Airi Tarutani, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Secondary antibodies were conjugated to 5 nm gold particles (Cytodiagnostics, 1:50). Immunostained grids were negatively stained with 2% phosphotungstic acid and dried ...
-
No products found
because this supplier's products are not listed.
Jacqueline F. Rivera, et al.,
bioRxiv - Neuroscience 2023
Quote:
The amino terminal domain of GluA1 (1-394 a.a.) fused to a biotin acceptor tag (AviTag, Avidity) grown in suspension cultures of Sf9 cells was used as a target for the mRNA display selection ...
-
No products found
because this supplier's products are not listed.
Lionel Schiavolin, et al.,
bioRxiv - Microbiology 2024
Quote:
... and anti-rabbit-HRP (Tebu-bio) secondary antibodies when required ...
-
No products found
because this supplier's products are not listed.
Jayanth S. Shankara Narayanan, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... anti-Rat HRP Polymer (Cell IDX, 2AH-100) or anti-Rabbit HRP Polymer (Cell IDX ...
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
Jiyun Chen, et al.,
bioRxiv - Biophysics 2023
Quote:
... CjLas1-Grc3 complex and CjLas1 truncated protein (HEPN domain) were first obtained using the sitting drop vapor diffusion method using high-throughput crystallization screening kits (Hampton Research, Molecular Dimensions and QIAGEN). Crystals were then grown in a mixed solution containing 1 μl complex solution and 1 μl of reservoir solution using the hanging drop vapor diffusion method at 16°C ...
-
No products found
because this supplier's products are not listed.
João L. Pereira, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... Tris-buffered saline with 0.1% Tween 20 was used for washing and antibody incubation as well as membrane blocking with 5% bovine serum albumin (cat. no. MB04602, NZYTech). The chemiluminescent signals were acquired by incubating the membrane with SuperSignal West Femto Maximum Sensitivity Substrate (cat ...
-
No products found
because this supplier's products are not listed.
Jing Zhou, et al.,
bioRxiv - Neuroscience 2023
Quote:
... A 5 × 5-cm white compressed cotton pad (Nestlets, Ancare) was placed in the center of the cage ...
-
No products found
because this supplier's products are not listed.
Laurent Jacob, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Serial cross sections (5□µm thick) were immunostained with rabbit anti-mouse LYVE1 (1:100) polyclonal antibody (11-034, AngioBio Co). DAB (3,3′ -Diaminobenzidine ...
-
ZKSCAN5 Antibody (HRP) is a Rabbit Polyclonal against ZKSCAN5.
Cat# abx338347-1MG,
1 mg USD $1885.0
Ask
Davide Piccolo, et al.,
bioRxiv - Molecular Biology 2024
Quote:
Cells were first washed with PBS and then incubated for 1 hour and 30 minutes at 5% CO2 and 37°C or 30°C with the primary antibody (Anti-ABCA4 Abbexa abx130549 1:300) diluted in DMEM containing 10% FBS ...
-
Decitabine, Free Base (5-aza-CdR, 5-aza-dC, AzadC, 5-Aza-2'-deoxycytidine, 5-Azadeoxycytidine, DAC, Dacogen, Dezocitidine, 2'-Deoxy-5-azacytidine, NSC-127716, CAS 2353-33-5), >99%
LC Laboratories' Product Number D-3899 - Decitabine, Free Base (5-aza-CdR, 5-aza-dC, AzadC,...
Cat# D-3899, SKU# D-3899_1g,
1 g, $366.00
Ask
Indra Bekere, et al.,
bioRxiv - Microbiology 2021
Quote:
... Staurosporine (LC Laboratories; 5 μM) or C646 (Merck ...
-
No products found
because this supplier's products are not listed.
Avery Rui Sun, et al.,
bioRxiv - Bioengineering 2023
Quote:
... SB-431542 (5 µM, Targetmol). All cells used in the in vitro sample reseeding studies were from passages 2 or 3 ...
-
No products found
because this supplier's products are not listed.
Eric L. Van Nostrand, et al.,
bioRxiv - Genomics 2020
Quote:
... A 5’-amino modifier (Glen Research) was coupled onto the end of sequences for subsequent conjugation with the polymer ...
-
No products found
because this supplier's products are not listed.
Brandon Cieniewicz, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... gag/pol (Aldevron, Cat# 5035-5), and rev (Aldevron ...
-
No products found
because this supplier's products are not listed.
Javier Emperador-Melero, et al.,
bioRxiv - Neuroscience 2021
Quote:
... 5% Fetal Select bovine serum (Atlas Biologicals), 2% B-27 supplement ...
-
No products found
because this supplier's products are not listed.
Cassandre Bedu-Ferrari, et al.,
bioRxiv - Microbiology 2024
Quote:
... 5% H2 atmosphere (Coy Lab Products, USA) (Text S1) ...
-
No products found
because this supplier's products are not listed.
Charles Bayly-Jones, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 5 μL of diluted C9-depleted serum (Complement Tech; diluted 1 in 5 with 1×DGHB; 2.5% (w/v) D-glucose ...
-
No products found
because this supplier's products are not listed.
Hao Chen, et al.,
bioRxiv - Animal Behavior and Cognition 2024
Quote:
... for 5 days followed by further feeding with the liquid control or ethanol diet (F1258SP, Bio-Serv, 5% ethanol) for 10 days ...
-
No products found
because this supplier's products are not listed.
Maria Alexandra Rujano, et al.,
bioRxiv - Developmental Biology 2021
Quote:
Measures of fluorescence intensities over time (Fig. 5 and Supp. Fig. 5-1c) were performed on Volocity 6.3 (Quorum technologies). For each region (GFP only ...
-
No products found
because this supplier's products are not listed.
Jun Feng, et al.,
bioRxiv - Synthetic Biology 2021
Quote:
... the cell pellets were resuspended into BMM-C and then inoculated into 5 mL BMM or BMM-xyloglucan media (5 g L-1 xyloglucan, Megazyme) to an initial OD600 of 0.05 ...
-
No products found
because this supplier's products are not listed.
Julie Firmin, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Embryos are placed in pre-equilibrated (at least 4 h at 37°C, 5% O2, 5% CO2) CSCM-C medium (Irvine Scientific) covered with mineral oil (Irvine Scientific ...
-
No products found
because this supplier's products are not listed.
Rebecca O’Cleirigh, Roslyn Gibbs,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... containing 5% (v/v) FCS and incubated overnight in a humidified atmosphere at 37°C and 5% CO2 (Nuaire, DH Autoflow). After 24 hours 1.5mL of the media was removed and media with herb extract or media only control was added ...
-
No products found
because this supplier's products are not listed.
Hannah A. Pizzato, et al.,
bioRxiv - Immunology 2023
Quote:
... or C5 antibody (Quidel) for 30min at 4°C ...
-
No products found
because this supplier's products are not listed.
Mohammad E. Afshar, et al.,
bioRxiv - Bioengineering 2019
Quote:
... 5 ng/mL basic fibroblast growth factor (bFGF; ImmunoTools) and 1% penicillin-streptomycin (Life Technologies) ...
-
No products found
because this supplier's products are not listed.
Adil Mohamed, et al.,
bioRxiv - Microbiology 2019
Quote:
... and analysis with FSC Express 5 (De Novo Software). Identical gates were applied to all samples of a given experiment ...
-
No products found
because this supplier's products are not listed.
Iain C. Clark, et al.,
bioRxiv - Genomics 2022
Quote:
... and shaken for 5 min (IKA, 253614 and 3426400) to ensure complete mixing ...
-
WB,ELISA
Cat# A5167, SKU# A5167-100ul,
100ul, $126.00
Ask
Xuxiao He, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... cell lysates were incubated with antibody-Flag or antibody-Myc affinity gel (Bimake) overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Alejandra Mondino, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Injections were performed at a rate of 5 nL/min using a Hamilton Neuros Syringe 7000 (5 mL; Hamilton Company, Reno, NV, USA) mounted on a microinjection syringe pump ...
-
No products found
because this supplier's products are not listed.
Andrew B. Stergachis, et al.,
bioRxiv - Genetics 2023
Quote:
... which preserves 3’ and 5’ end information (PacBio, Menlo Park, CA). A PacBio SMRTbell library was constructed using these PCR-amplified full-length cDNA transcripts and sequenced using a Sequel II ...
-
No products found
because this supplier's products are not listed.
Yann Aquino, et al.,
bioRxiv - Genomics 2022
Quote:
... mouse monoclonal antibody (PBL Assay Science) was used to coat paramagnetic beads at a concentration of 0.3 mg/mL ...
-
No products found
because this supplier's products are not listed.
Carolin Berwanger, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Resuspended cells were homogenised in a 5 mL Dounce homogeniser (Wheaton Type B) by ten quick strokes of a tight-fitting puncher avoiding foam formation ...
-
No products found
because this supplier's products are not listed.
Irina Sbornova, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Whole eye blots were probed overnight at 4 °C with 1 of two PDE11A antibodies: the pan-PDE11A antibody PD11-112 (1:1000, rabbit, Fabgennix) or the PDE11A4-specific antibody PDE11A#1-8113A (1:10,000 ...
-
No products found
because this supplier's products are not listed.
Sushant Bhat, et al.,
bioRxiv - Microbiology 2021
Quote:
... (ID Vet) and Influenza A Antibody ELISA (IDEXX) were performed according to manufacturers’ instructions.
-
No products found
because this supplier's products are not listed.
Peter C. Petersen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... A 5-mm long polyimide tube (EW-95820-05, Cole-Parmer, Vernon Hills, IL) was attached around the silver wire ...
-
No products found
because this supplier's products are not listed.
Marie-Françoise Montaron, et al.,
bioRxiv - Neuroscience 2020
Quote:
... one-in-ten sections were incubated with different anti-BrdU antibodies (BrdU & CldU, rat primary antibodies at 1/200 Accurate Chemical; IdU ...
-
No products found
because this supplier's products are not listed.
Jens C. Luoto, et al.,
bioRxiv - Cell Biology 2020
Quote:
... both packed with 5 μm ReproSil-Pur 200 Å C18 silica particles (Dr. Maisch HPLC GmbH). The peptides were separated using a 60 min gradient (5-42 % B in 50min ...
-
No products found
because this supplier's products are not listed.
Cindy F. Yang, et al.,
bioRxiv - Neuroscience 2019
Quote:
Anti-somatostatin-14 antibody (Peninsula Laboratories, Cat# T-4103.0050, RRID: AB_518614) was raised in rabbit against the first 14 aa of the synthetic peptide SST ...
-
No products found
because this supplier's products are not listed.
Ria Göttert, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Primary antibodies were applied in the following concentrations: mouse anti-CD45 (EXBIO) 1:100 ...