-
No products found
because this supplier's products are not listed.
Miriam R. Fein, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Fc receptor blocker (Innovex Biosciences), and finally avidin/biotin blocking buffer (Vector Laboratories ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Joanna Bednarska, et al.,
bioRxiv - Cell Biology 2020
Quote:
... topographical images of samples immersed in liquid by raster scanning a glass nanopipette (probe) that follows the surface of a sample very closely without touching (Adenle & Fitzgerald, 2005 ...
-
No products found
because this supplier's products are not listed.
Marie-Lise Jobin, et al.,
bioRxiv - Cell Biology 2022
Quote:
... LigandTag Lite D2 (L0002RED) receptor red antagonist was purchased from Cisbio Bioassays ...
-
No products found
because this supplier's products are not listed.
Alice Wedler, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... Cell density was monitored by an Incucyte S3 (Sartorius) and analyzed using the AI Cell Health Analysis Software (v2022B) ...
-
No products found
because this supplier's products are not listed.
Tetyana P. Buzhdygan, et al.,
bioRxiv - Neuroscience 2020
Quote:
... spike protein subunit S2 or receptor binding domain (RBD) sequence of S1 (RayBiotech, Cat No 230-01101 ...
-
No products found
because this supplier's products are not listed.
Rémi Veneziano, et al.,
bioRxiv - Immunology 2020
Quote:
... Low melt agarose was purchased from IBI Scientific (#IB70058) and the agarose from Seakem ...
-
No products found
because this supplier's products are not listed.
Yury Bykov, et al.,
bioRxiv - Cell Biology 2019
Quote:
... 2006) in high-density format using a RoToR bench top colony arrayer (Singer Instruments).
-
No products found
because this supplier's products are not listed.
Mehrdad Zarei, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... The primary antibodies were diluted (SignalStain Antibody Diluent; 8112) and incubated overnight at 4 °C using the following antibodies: Ki67 (SP6, BioCare Medical) and cleaved caspase 3 (Cell Signaling Technology ...
-
No products found
because this supplier's products are not listed.
Ishaan Puranam, et al.,
bioRxiv - Bioengineering 2019
Quote:
Low-density hippocampal cultures were prepared from E19 rat embryos as described previously (Zhang et al., 2003) (ScienCell Research Laboratories,), and experiments were carried out in compliance with the Guide for the Care and Use of Laboratory Animals of the National Institutes of Health and approved by the University of Virginia Animal Care and Use Committee (Protocol Number ...
-
No products found
because this supplier's products are not listed.
Denzil Furtado, et al.,
bioRxiv - Bioengineering 2022
Quote:
... fibroblasts were switched to DMEM supplemented with 5% fetal bovine lipoprotein deficient serum (Alpha Diagnostic International), 100 U/ml penicillin and 100 μg/ml streptomycin ...
-
No products found
because this supplier's products are not listed.
A Bañón, B Alsina,
bioRxiv - Developmental Biology 2023
Quote:
Long and very thin injecting needles were done in an electrophysiology puller (Sutter instruments model P-97) with the following protocol ...
-
No products found
Kristel Martinez Lagunas, et al.,
bioRxiv - Cell Biology 2022
Quote:
... the lungs were cut in very small pieces and digested in 1.5 ml of Collagenase Type 2 (Worthington, 44N15307B) for one hour at 37°C and 500 rpm ...
-
No products found
because this supplier's products are not listed.
Mohan Kumar Muthu Karuppan, et al.,
bioRxiv - Immunology 2019
Quote:
... Pregnant dams received anti-interferon receptor 1 (anti-IFNAR1) monoclonal antibody (MAR-5A3, Leinco Technologies, MO, USA) at 2mg/animal via intraperitoneal (ip ...
-
No products found
because this supplier's products are not listed.
Clara Schmidt, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... according to the manufacturer’s protocol (incubated for 10 – 20 minutes at 37°C to thoroughly dissociate organoids) and subsequently seeded at low densities of 15 – 40k cells in Laminin-511 E8 Fragment (AMSBIO, #AMS.892 011, 0.5 µg/cm²) coated 35 mm tissue culture-treated dishes (Corning ...
-
No products found
because this supplier's products are not listed.
Lukasz Chrobok, et al.,
bioRxiv - Neuroscience 2021
Quote:
... maxadilan (MAX; PAC1 receptor agonist; 100 nM; Bachem) and TCS-OX2-29 (TCS ...
-
No products found
because this supplier's products are not listed.
Kerrie L. Marie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Lot# CA36131)/ 1:400 KDEL Receptor 3 (L95) polyclonal (Bioworld Technology Cat# BS3124 ...
-
No products found
because this supplier's products are not listed.
Iris I.A. Groen, et al.,
bioRxiv - Neuroscience 2021
Quote:
... high-density grid (PMT Corporation), which provided denser sampling of underlying cortex ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Jie Zhang, et al.,
bioRxiv - Genomics 2023
Quote:
... using density gradient medium Pancoll (Solarbio). The obtained PBMCs were then washed by cold PBS for three times ...
-
No products found
because this supplier's products are not listed.
Michael J. Robertson, et al.,
bioRxiv - Biophysics 2022
Quote:
All receptors were expressed in Sf9 insect cells (Expression Systems) infected at a density of 3-4 million cells/ml ...
-
No products found
because this supplier's products are not listed.
Yan Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or anti-PAC1 receptor (1:50 dilution, LifeSpan BioSciences, Inc.) at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Eleanor M Denham, et al.,
bioRxiv - Immunology 2019
Quote:
Cells were analysed for receptor surface expression by flow cytometry using anti-Strep-tag II antibody Oyster 645 (IBA Lifesciences # 2-1555-050), or anti-Strep-tag II antibody (IBA Lifesciences # 2-1507-001 ...
-
No products found
because this supplier's products are not listed.
Liu Han, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Density was assessed with a refractometer (Carl Zeiss). Fractions were diluted with 2.5 ml sterile PBS and centrifuged for 30 min at 100,000 × g (43,000 rpm ...
-
No products found
because this supplier's products are not listed.
Kim S. Friedmann, et al.,
bioRxiv - Immunology 2020
Quote:
... density gradient centrifugation using Lymphocyte Separation Medium 1077 (PromoCell) was carried out as described before (Knorck et al. ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Nargess Farhangdoost, et al.,
bioRxiv - Genomics 2020
Quote:
... and NxSeq AmpFREE Low DNA Library Kit (Lucigen) was applied ...
-
No products found
because this supplier's products are not listed.
Robert C. Hurt, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Cells were resuspended with 1% low-melt agarose (GoldBio) in PBS at 40°C at ~30 million cells/mL (Fig ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
Einat Bigelman, et al.,
bioRxiv - Cell Biology 2022
Quote:
... which recognizes the native form of the extracellular portion of the receptor (Biorbyt, England, clone orb399781) followed by flow cytometry analysis.
-
No products found
because this supplier's products are not listed.
Rebecca A. Lea, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... qRT-PCR was performed using SensiMix SYBR low-ROX kit (Bioline) on a QuantStudio5 machine (Thermo Fisher) ...
-
No products found
because this supplier's products are not listed.
Luana dos Santos Ortolan, et al.,
bioRxiv - Pathology 2019
Quote:
Soluble endothelial protein C receptor (sEPCR) was measured with an ELISA kit (Elabscience®, E-EL-M1073) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Thusitha K. Karunarathna, et al.,
bioRxiv - Microbiology 2023
Quote:
Binding of virus and sialic receptor analogous was measured using an Octet Red biolayer interferometer (Pall FortéBio) as previously described (37) ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
MR Melo, et al.,
bioRxiv - Neuroscience 2022
Quote:
... delivered in oxygen using a SomnoSuite low-flow anesthesia delivery system (Kent Scientific). Body temperature was maintained at 37.5 °C with a TC-1000 heat pad (CWE Inc.) ...
-
No products found
because this supplier's products are not listed.
Zhang-He Goh, Jie Kai Tee, Han Kiat Ho,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... 20 µL of this suspension was mixed with low-melting agarose (Trevigen, United States), spread evenly over CometSlides (Trevigen ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Sohei Yamada, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The laminin density was evaluated by coating the dish with laminin conjugated to a fluorescent dye (green fluorescent HiLyte 488; Cytoskeleton), which was observed under a confocal laser scanning microscope (Zeiss LSM710 ...
-
No products found
because this supplier's products are not listed.
Mario K. Shammas, et al.,
bioRxiv - Cell Biology 2021
Quote:
... primary antibody followed by secondary antibodies (Nanogold, Nanoprobes, Yaphank, NY) for 1-2 hours ...
-
No products found
because this supplier's products are not listed.
Chongping Li, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and goat anti-mouse IgG secondary antibody (L3032, Signalway Antibody).
-
No products found
because this supplier's products are not listed.
Farès Ousalem, et al.,
bioRxiv - Microbiology 2023
Quote:
... an HRP-conjugated antibody (Anti-rabbit IgG, antibody [HRP] from COVALAB) diluted 20,000x in PBS was used ...
-
No products found
because this supplier's products are not listed.
Roy G. Muriu, Jessica M. Sage, Abdulbaki Agbas,
bioRxiv - Neuroscience 2019
Quote:
... MBL antibodies (MBL International, 15A Constitution way ...
-
No products found
because this supplier's products are not listed.
Subhasri Ghosh, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Casper-1 antibody (AdipoGen) and corresponding mouse IgG (CST ...
-
No products found
because this supplier's products are not listed.
Carson D. Bickley, Arash Komeili,
bioRxiv - Cell Biology 2024
Quote:
... primary antibody anti-MamE polyclonal antibody (1:3,000 dilution, produced by ProSci Inc), secondary antibody F(ab’)2-goat anti-mouse IgG (H+L ...
-
No products found
because this supplier's products are not listed.
Yuebiao Feng, et al.,
bioRxiv - Microbiology 2021
Quote:
... Immunoblotting was performed using standard procedures using the antibodies rabbit anti‐Per1 antibody (1:5000) and mouse anti‐β‐Actin antibody (1:2000) (Abbkine, China). The rabbit polyclonal anti‐Per1 antibody was generated against recombinant Per1 protein (recPer1 ...
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Katharina Hutter, et al.,
bioRxiv - Immunology 2022
Quote:
... Bound antibodies were visualized with HRP-labeled secondary antibodies and the ECL system (Advansta) on a light-sensitive film (Amersham ...
-
No products found
because this supplier's products are not listed.
Martin Privat, et al.,
bioRxiv - Neuroscience 2024
Quote:
... the primary antibody used was a rabbit anti-GFP antibody (TP401, Torrey pines biolabs) diluted 1:1000 in blocking buffer for overnight incubation ...
-
No products found
because this supplier's products are not listed.
Boris Bonaventure, et al.,
bioRxiv - Microbiology 2021
Quote:
... or J2 anti-dsRNA antibody (SCICONS), or anti-SARS-CoV-2 Nucleoprotein (N ...
-
No products found
because this supplier's products are not listed.
Milou E. Noltes, et al.,
bioRxiv - Cell Biology 2022
Quote:
... antibodies to PTH (1:100, Boster), CaSR (1:100 ...
-
No products found
because this supplier's products are not listed.
Emily M. Sontag, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Anti-Nsp1 antibody from EnCor Biotechnology was used to visualize nuclear pores and Anti-Nsr1 antibody from Abcam was used for staining the nucleolus.