-
No products found
because this supplier's products are not listed.
Miglė Kišonaitė, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Boc-L-R-R-AMC (trypsin-like activity) and Z-L-L-E-AMC (caspase-like activity) (Boston Biochem). The proteasome samples were incubated with 50 μM AMC-peptide in the respective purification buffers (standard or the exogenous nucleotide depleted buffer ...
-
No products found
because this supplier's products are not listed.
Mohan Kumar Muthu Karuppan, et al.,
bioRxiv - Immunology 2019
Quote:
... Pregnant dams received anti-interferon receptor 1 (anti-IFNAR1) monoclonal antibody (MAR-5A3, Leinco Technologies, MO, USA) at 2mg/animal via intraperitoneal (ip ...
-
No products found
because this supplier's products are not listed.
Ayan Rajgarhia, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... cells were then treated with either an anti-5’ methylcytidine (5MeC) monoclonal antibody (Epigentek, Catalog No. A-1014), or non-specific IgG1 (BD Biosciences ...
-
No products found
because this supplier's products are not listed.
Chun-Yang Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... brain slices were rinsed 3 times in PBS (5 min each) and then were incubated in fluorochrome-conjugated secondary antibody (1:200, Dylight488-conjugated goat anti-rabbit Abbkine; 1:200 ...
-
No products found
because this supplier's products are not listed.
Yue Wang, et al.,
bioRxiv - Biophysics 2021
Quote:
... 3 μl of purified ghrelin-bound complex at 13 mg/ml and GHRP-6-bound ghrelin receptor complex at 8 mg/ml were applied individually onto a glow-discharged holey carbon grid (Quantifoil, Au300 R1.2/1.3) in a Vitrobot chamber (FEI Vitrobot Mark IV) ...
-
No products found
because this supplier's products are not listed.
Bingyi Li, et al.,
bioRxiv - Cell Biology 2023
Quote:
... and Cal590 (5 μM, AAT Bioquest) were used for the indication of mitochondria ...
-
No products found
because this supplier's products are not listed.
Svenja K. Tetzlaff, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... Thresholds for decay times were established from recordings in the presence of the GABAA receptor antagonist gabazine (Biotrend, 5 µM), or the AMPA-receptor blocker 2,3-dihydroxy-6-nitro-7-sulfamoyl-benzo[f]quinoxaline (NBQX ...
-
No products found
because this supplier's products are not listed.
Yisong Qian, et al.,
bioRxiv - Immunology 2021
Quote:
... SARS-CoV-2 papain-like protease (DB604) was purchased from Lifesensors (Malvern, PA). HCoV-HKU1 coronavirus nucleocapsid protein ...
-
No products found
because this supplier's products are not listed.
Nicholas J Swanson, et al.,
bioRxiv - Microbiology 2023
Quote:
... Lyophilized Receptor Destroying Enzyme II (RDE, Hardy Diagnostics) was dissolved into 20 mL of saline (0.9% NaCl in H2O ...
-
No products found
because this supplier's products are not listed.
Brogan Ashley, et al.,
bioRxiv - Physiology 2021
Quote:
... or 2 μM Receptor Associated Protein (RAP; Innovative Research, USA), which block pinocytosis ...
-
No products found
because this supplier's products are not listed.
MT Heemskerk, et al.,
bioRxiv - Immunology 2021
Quote:
... diluted in PBS for 10 min at RT and Fc-receptors were subsequently blocked using 5% human serum (HS; Sanquin Blood bank, Amsterdam, The Netherlands) for 45 min at RT ...
-
No products found
because this supplier's products are not listed.
Wendy Leung, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... Primary antibodies were incubated in 5% BLOT-QuickBlocker (G-Biosciences 786-011) as follows ...
-
No products found
because this supplier's products are not listed.
Allison R. Fusilier, et al.,
bioRxiv - Neuroscience 2021
Quote:
... BMAL1 (1:1000 in 5% BSA and TBST, Signalway Antibody, LLC, #21415,), GSK3β (3D10 ...
-
No products found
because this supplier's products are not listed.
Tony Ngo, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... and 1.0 μg/well of the indicated receptors using TransIT-X2 transfection reagent (Mirus Bio); the total transfected DNA was normalized to 3.0 μg/well for all wells using empty pcDNA3.1 ...
-
No products found
because this supplier's products are not listed.
Lorena Galera-López, et al.,
bioRxiv - Neuroscience 2021
Quote:
... a mixture of equal amounts (1:100) of guinea pig anti-CB1R antibody (Frontier Science) and rabbit anti-5-HT2AR antibody (Neuromics) was used together with PLA probes detecting guinea pig or rabbit antibodies ...
-
No products found
because this supplier's products are not listed.
Chirag H Patel, et al.,
bioRxiv - Immunology 2023
Quote:
... containing chimeric antigen receptor (CAR) was made using Platinum-E (Plat-E) Retroviral Packaging Cell Line (Cell Biolabs). Fresh virus with human IL-2 was spin fected onto retronectin coated plates according to protocol (33156338) ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Rachael Kuintzle, et al.,
bioRxiv - Systems Biology 2023
Quote:
... All of the Notch receptor piggyBac constructs were derived from the vector PB-CMV-MCS-EF1-Puro (System Biosciences), with changes made to the promoter (CMV changed to PGK or CAG ...
-
No products found
because this supplier's products are not listed.
Samuel K Powell, et al.,
bioRxiv - Neuroscience 2021
Quote:
... diluted primary antibodies were added in 5% donkey serum and 0.1% Tween-20 (Boston BioProducts, #IBB-181X) in PBS and incubated overnight at 4 °C ...
-
No products found
because this supplier's products are not listed.
Ignacio Fernández, et al.,
bioRxiv - Microbiology 2022
Quote:
... Heparan sulfate was detected by staining with F58-10E4 antibody (5 μg/ml, AmsBio, UK #370255-S) and anti-mouse IgM-AF488 antibodies (2 μg/ml ...
-
No products found
because this supplier's products are not listed.
Melissa Govender, et al.,
bioRxiv - Immunology 2022
Quote:
... including anti-spike neutralizing IgG antibodies directed against the receptor binding domain (RBD) of S1 subunit was performed using a commercial chemiluminescent microparticle-based immune assay (Abbott SARS-CoV-2 IgG II Quant/6S60 ARCHITECT SARS-CoV-2 IgG kit ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Pawel J. Sikorski, et al.,
bioRxiv - Biochemistry 2019
Quote:
... blocked with 5% non-fat dried milk in PBST buffer and incubated either with mouse monoclonal J2 antibody (SCICONS) or with mouse monoclonal anti-m7G cap antibody (H-20 ...
-
No products found
because this supplier's products are not listed.
Alexandra Zak, et al.,
bioRxiv - Biophysics 2019
Quote:
Silica beads (5 × 106; 5 μm diameter; Bangs Laboratories) were washed in distilled water (5,000 rpm ...
-
No products found
because this supplier's products are not listed.
Donggi Paik, et al.,
bioRxiv - Immunology 2021
Quote:
... 5% FBS (Genesee), 1 g/L cellobiose (Sigma) ...
-
No products found
because this supplier's products are not listed.
Sarah Hofmann, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 5 ug/ml insulin (PromoCell), 0.5 ug/ml Hydrocortisone ...
-
No products found
because this supplier's products are not listed.
K. Saini, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 5(6)-CTAMRA (Carbosynth/Novabiochem); TFA (Alfa Aesar) ...
-
No products found
because this supplier's products are not listed.
Haleigh N. Mulholland, et al.,
bioRxiv - Neuroscience 2024
Quote:
... a 5 MΩ electrode (FHC) was driven approximately 7 mm down perpendicularly into the brain using a micromanipulator ...
-
No products found
because this supplier's products are not listed.
Yu-Heng Tseng, et al.,
bioRxiv - Plant Biology 2022
Quote:
... Membranes were saturated with 5% milk powder in PBS with 0,05% Tween-20 (PBS-T) followed by immunostaining with anti-GFP antibodies (Torrey Pines Biolabs, 1:5000 in PBS-T) and secondary goat-anti-rabbit antibodies coupled to alkaline phosphatase (Applied Biosystems ...
-
No products found
because this supplier's products are not listed.
Giulio Giuliani, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 5% horse serum (HS) (Euroclone ECS0090D) and 1 ng/ml TGF-beta-1 (PreproTech 100-21) ...
-
No products found
because this supplier's products are not listed.
Michael J. Hoy, et al.,
bioRxiv - Microbiology 2022
Quote:
... 5 M Sodium Chloride (Teknova #S0251), TCEP (Soltec Ventures Inc #M115) ...
-
No products found
because this supplier's products are not listed.
Sloan Jen, et al.,
bioRxiv - Plant Biology 2022
Quote:
... 5% silica sand and 0.5% Osmocote Extract Standard 5–6 month slow-release fertilizer (ICL, Ipswich, UK) by volume ...
-
No products found
because this supplier's products are not listed.
F. Abrar, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and heavy isotopes (4, 4, 5, 5-D4 L-lysine and 13C6 L-arginine, Cambridge Isotope Laboratories (CIL)) for the K4/R6 population ...
-
No products found
because this supplier's products are not listed.
Stephan Kamrad, et al.,
bioRxiv - Genetics 2019
Quote:
... column (New Objective, PF360-75-10-N-5) packed in house with 1.9 um C18 beads (Dr ...
-
No products found
because this supplier's products are not listed.
Luke R. Joyce, et al.,
bioRxiv - Microbiology 2022
Quote:
... with ~5-8 2.7 mm glass beads (BioSpec). Clots were homogenized for 10-15 min horizontally on a vortex before serial dilution and plating on THB agar plates for enumeration ...
-
No products found
because this supplier's products are not listed.
Desingu Ayyappa Raja, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... at 5% CO2 (Eppendorf® New Brunswick Galaxy170S). Media was changed every day and cells were passaged upon reaching 80% confluence ...
-
No products found
because this supplier's products are not listed.
Andrew P. Tosolini, et al.,
bioRxiv - Neuroscience 2021
Quote:
... glass micropipettes (Drummond Scientific, 5-000-1001-X10), as previously described (Mohan et al. ...
-
No products found
because this supplier's products are not listed.
Farès Ousalem, et al.,
bioRxiv - Microbiology 2023
Quote:
... an HRP-conjugated antibody (Anti-rabbit IgG, antibody [HRP] from COVALAB) diluted 20,000x in PBS was used ...
-
No products found
because this supplier's products are not listed.
Victoria A. Bonnell, et al.,
bioRxiv - Genomics 2023
Quote:
... Sonicate the chromatin until sufficiently sheared (130µL, 5% duty cycle, 75W peak incident power, 200 cycles per burst, 7°C, for 5 minutes using Covaris Focus-Ultrasonicator M220). The immunoprecipitation step included ...
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Katharina Hutter, et al.,
bioRxiv - Immunology 2022
Quote:
... Bound antibodies were visualized with HRP-labeled secondary antibodies and the ECL system (Advansta) on a light-sensitive film (Amersham ...
-
No products found
because this supplier's products are not listed.
MR Melo, et al.,
bioRxiv - Neuroscience 2022
Quote:
... the multi-lead electrode pedestal was connected to an amplifier (10 Hz-5 KHz band-pass filter, 5 kHz sampling rate, Model 1700 Differential AC amplifier, A-M systems, Sequim, WA, USA). The signal was recorded and integrated using Spike2 version 9.0 software (Cambridge Electronic Design).
-
No products found
because this supplier's products are not listed.
Florian Wiede, et al.,
bioRxiv - Immunology 2019
Quote:
Serum anti-nuclear antibodies were detected with the mouse anti-nuclear antibodies Ig’s (total IgA+G+M) ELISA Kit from Alpha Diagnostic International ...
-
No products found
because this supplier's products are not listed.
Laura Schenkel, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 5 the GFP-Like (Em 520/35) and DsRed-like (Em 617/73) Emission Filter Wheels and 2x Evolve 512 cameras (Photometrics; Tucson, Arizona, United States) were used ...
-
No products found
because this supplier's products are not listed.
Daniel Rand, et al.,
bioRxiv - Neuroscience 2020
Quote:
Brain-like endothelial cell and pericytes were grown in ECM medium (Sciencell, United States) that was composed as follows ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Qi Wang, et al.,
bioRxiv - Microbiology 2019
Quote:
... the antibody to LPS core (Hycult Biotech, Uden, Netherlands; Clone WN1 222-5) was used at a concentration of 1:300 overnight at 4°C(1).
-
No products found
because this supplier's products are not listed.
Takushi Shimomura, et al.,
bioRxiv - Biophysics 2022
Quote:
In PI(3, 5)P2-injection experiments, 5 mM PI(3, 5)P2–diC8 (Echelon Biosciences) was manually injected by positive pressure using the glass needle filled with the PI(3 ...
-
No products found
because this supplier's products are not listed.
Matthew Gemberling, et al.,
bioRxiv - Genomics 2021
Quote:
... 1° Antibodies were incubated in 5% milk in TBS-T and used at the following manner: Anti-Cas9 (EnCor Biotechnology/Cat#MCA-3F)-1:2000 at room temp for 2-3 hours ...
-
No products found
because this supplier's products are not listed.
R Arce-Molina, et al.,
bioRxiv - Cell Biology 2019
Quote:
... exposed to 5 × 106 PFU of Ad Pyronic (serotype 5, custom made by Vector Biolabs), and studied after 16-24 h ...
-
No products found
because this supplier's products are not listed.
Sean K. Ryan, et al.,
bioRxiv - Pathology 2019
Quote:
... 5 ml Betaflour (National Diagnostics LS-151) was added to each scintillation vial ...