-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Renée M. van der Sluis, et al.,
bioRxiv - Immunology 2021
Quote:
... antibodies blocking the type I IFN receptor (mouse anti-human IFNAR2 antibody, clone MMHAR-2, PBL Assay Science Cat#21385-1) or isotype control (Ultra-LEAF Purified mouse IgG2a ...
-
No products found
because this supplier's products are not listed.
Shuiyun Lan, et al.,
bioRxiv - Microbiology 2021
Quote:
... A chimeric neutralizing antibody specific against SARS-CoV-2 S protein receptor binding domain (NR-55410) was provided by ACROBiosystems through BEI resources.
-
No products found
because this supplier's products are not listed.
MegAnne Casey, et al.,
bioRxiv - Neuroscience 2023
Quote:
... using the primary antibodies rabbit anti-cleaved caspase-3 (Trevigen) and chicken anti-Atp7a (Sigma) ...
-
No products found
because this supplier's products are not listed.
Florian A. Lempp, et al.,
bioRxiv - Microbiology 2021
Quote:
... were transfected with plasmids encoding the following receptor candidates (all purchased from Genecopoeia): ACE2 (NM_021804) ...
-
No products found
because this supplier's products are not listed.
Marie-Dominique Jolivet, et al.,
bioRxiv - Plant Biology 2023
Quote:
... 6His-AtREM1.21–118 was produced like GST-CPK and purified on Protino® Ni-TED column following manufacturer’s instructions (Macherey-Nagel). After elution with 40-250 mM imidazole ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
O Bogen, et al.,
bioRxiv - Neuroscience 2024
Quote:
... psi ε receptor for activated C kinase (ψεRACK) (27) was purchased from Biomatik (Wilmington, DE, USA), and the proinflammatory cytokine prostaglandin-E2 (PGE2 ...
-
No products found
because this supplier's products are not listed.
Milou W.M. Meeuse, et al.,
bioRxiv - Systems Biology 2020
Quote:
... we replaced the previous 3.5- cm dishes with a “sandwich-like” system: The bottom consisted of a glass cover slip onto which two silicone isolators (GRACE Bio-Labs, SKU: 666103) with a hole in the middle were placed on top of each other and glued onto the glass cover slip ...
-
No products found
because this supplier's products are not listed.
Rachael Kuintzle, et al.,
bioRxiv - Systems Biology 2023
Quote:
... All of the Notch receptor piggyBac constructs were derived from the vector PB-CMV-MCS-EF1-Puro (System Biosciences), with changes made to the promoter (CMV changed to PGK or CAG ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Petra Vizjak, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Cyanin-3-maleimide (Lumiprobe) was dissolved in DMSO to final concentration 100 mM and added to solution in 5.7 fold excess ...
-
No products found
because this supplier's products are not listed.
Subash Godar, et al.,
bioRxiv - Biophysics 2021
Quote:
... We detected the bound alkaline phosphatase labeled antibodies by incubating the membrane in BCIP/NBT (5-bromo, 4-chloro, 3- indolylphosphate/nitro-blue tetrazolium, AMRESCO, LLC.) substrate for 30–45 minutes ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Rebecca J. Edgar, et al.,
bioRxiv - Microbiology 2019
Quote:
... 32 using the AmpliteTM Fluorimetric sn-Glycerol-3-Phosphate (Gro-3-P) Assay Kit (AAT Bioquest). GAC was released from cell wall by sequential digestion with mutanolysin hydrolase and PlyC amidase ...
-
No products found
because this supplier's products are not listed.
Kate L. Vasquez Kuntz, et al.,
bioRxiv - Evolutionary Biology 2020
Quote:
... 3 mM MgCl (Bioline, Boston, MA), 1 mM dNTP (Bioline ...
-
No products found
because this supplier's products are not listed.
Subhas C. Bera, et al.,
bioRxiv - Biophysics 2021
Quote:
... Model 3 includes dissociation from RPI and is solved in the context of three assumptions for which we have an analytical solution ...
-
No products found
because this supplier's products are not listed.
Félix Buron, et al.,
bioRxiv - Neuroscience 2023
Quote:
... etched tungsten microelectrodes (3-5MΩ, FHC) that were inserted into the brain using 26-gauge guide tubes that were passed through the recording grid and small predrilled burr holes in the skull ...
-
No products found
because this supplier's products are not listed.
Sara Castagnola, et al.,
bioRxiv - Genomics 2020
Quote:
... Both the MINIPULS 3 peristaltic pump (Gilson) and the cytometer flow rate were set to 39 μl/min ...
-
No products found
because this supplier's products are not listed.
Joep Houkes, et al.,
bioRxiv - Synthetic Biology 2021
Quote:
... resuspension buffer supplemented with 3 μL 1000 U/mL Zymolase (Amsbio) and incubated for 30 min at 37 °C to digest the cell walls ...
-
No products found
because this supplier's products are not listed.
Jia Tian, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... chicken anti-type 3 adenylyl cyclase (1:5000; Encor Biotechnology; Cat# CPCA-ACIII), and rabbit anti-PCM1 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Yuebiao Feng, et al.,
bioRxiv - Microbiology 2021
Quote:
... Immunoblotting was performed using standard procedures using the antibodies rabbit anti‐Per1 antibody (1:5000) and mouse anti‐β‐Actin antibody (1:2000) (Abbkine, China). The rabbit polyclonal anti‐Per1 antibody was generated against recombinant Per1 protein (recPer1 ...
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Katharina Hutter, et al.,
bioRxiv - Immunology 2022
Quote:
... Bound antibodies were visualized with HRP-labeled secondary antibodies and the ECL system (Advansta) on a light-sensitive film (Amersham ...
-
No products found
because this supplier's products are not listed.
Martin Privat, et al.,
bioRxiv - Neuroscience 2024
Quote:
... the primary antibody used was a rabbit anti-GFP antibody (TP401, Torrey pines biolabs) diluted 1:1000 in blocking buffer for overnight incubation ...
-
No products found
because this supplier's products are not listed.
Brenda Vasquez, et al.,
bioRxiv - Neuroscience 2022
Quote:
... For these experiments we used 3 hemizygous transgenic Ai162D mice (Ai162(TIT2L-GC6s-ICL-tTA2)-D ...
-
No products found
because this supplier's products are not listed.
Florian Wiede, et al.,
bioRxiv - Immunology 2019
Quote:
Serum anti-nuclear antibodies were detected with the mouse anti-nuclear antibodies Ig’s (total IgA+G+M) ELISA Kit from Alpha Diagnostic International ...
-
No products found
because this supplier's products are not listed.
Jeong Min Lee, et al.,
bioRxiv - Biochemistry 2024
Quote:
... FMS-like Tyrosine Kinase 3 Ligand (Flt3L, 100 ng/ml) (CellGenix, 1415-050) and Thrombopoietin (TPO ...
-
No products found
because this supplier's products are not listed.
Suman Khan, et al.,
bioRxiv - Microbiology 2023
Quote:
... 10.8% Drug Like Set (Enamine, Ukraine), 26.8% DiversetCL (Chembridge ...
-
No products found
because this supplier's products are not listed.
Yisong Qian, et al.,
bioRxiv - Immunology 2021
Quote:
... SARS-CoV-2 papain-like protease (DB604) was purchased from Lifesensors (Malvern, PA). HCoV-HKU1 coronavirus nucleocapsid protein ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
This product is a 103.8 kDa Human TLR3 membrane protein expressed in HEK293. The protein is for...
Cat# MPC1465K,
1.0 case, Inquiry
Ask
Andrew D. Hoffmann, et al.,
bioRxiv - Immunology 2022
Quote:
... Results were normalized to the CR3022 antibody with known affinity to the receptor binding domain of SARS-CoV2 (Creative Biolabs, MRO-1214LC)(29 ...
-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
No products found
because this supplier's products are not listed.
Xusheng Qiu, et al.,
bioRxiv - Microbiology 2020
Quote:
... Mouse anti-glyceraldehyde-3-phosphate dehydrogenase (GAPDH) monoclonal antibody was purchased from Meridian Life Science. Horseradish peroxidase (HRP)-conjugated anti-human ...
-
No products found
because this supplier's products are not listed.
Pengcheng Liu, et al.,
bioRxiv - Genomics 2022
Quote:
... and gene expressions of apoLp and POA3-like after male feeding on dsRNAapoLp were evaluated by qRT-PCR analysis (ABI StepOne Plus, Foster, CA) using TB Green Premix Ex Taq II (Catalog No ...
-
No products found
because this supplier's products are not listed.
Agnès Roure, Rafath Chowdhury, Sébastien Darras,
bioRxiv - Developmental Biology 2022
Quote:
... or 2.5 μM of the BMP receptor inhibitor DMH1 (S7146, Euromedex, 10 mM stock solution in DMSO) at the stages indicated in the text and figures ...
-
No products found
because this supplier's products are not listed.
Nuno Apóstolo, et al.,
bioRxiv - Neuroscience 2020
Quote:
... MF-CA3 synaptosomes were labeled in non-permeabilizing conditions in PBS with an anti-Nectin 3 monoclonal antibody (1:50; Hycult Biotech) directly conjugated with CF488A fluorophore (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Anne-Sophie Hafner, et al.,
bioRxiv - Neuroscience 2019
Quote:
... The next day grids were washed 5x 3 min with TBS before being incubated with anti-rabbit antibody coupled to ~10mn colloidal gold (BBI solution, 1:50) for 2 h ...
-
No products found
because this supplier's products are not listed.
Vidur Garg, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... and 3 µM GSK3βi/CHIR99021 (Reprocell) (‘AGi’ media ...
-
No products found
because this supplier's products are not listed.
Marta Robertson, et al.,
bioRxiv - Plant Biology 2020
Quote:
... and 3 SMRT cells (v3) respectively (PacBio RSII ...
-
No products found
because this supplier's products are not listed.
Zhi Liu, et al.,
bioRxiv - Physiology 2022
Quote:
... and rectal probe (Kent Scientific, RET-3). Before recording temperatures ...
-
No products found
because this supplier's products are not listed.
Brandon S. Johnson, et al.,
bioRxiv - Plant Biology 2023
Quote:
... and a 3 hr Solusol (National Diagnostics) digestion to dissolve the cell wall fraction ...
-
No products found
because this supplier's products are not listed.
Vladimir Girik, et al.,
bioRxiv - Cell Biology 2023
Quote:
3 μm carboxyl polystyrene beads (Spherotech, CP30-10) were covalently coupled with purified human IgG (hIgG ...
-
No products found
because this supplier's products are not listed.
Chao Gao, et al.,
bioRxiv - Biochemistry 2020
Quote:
... for 3 min and separated on a C18 analytical column (picofrit 75 μm ID x 150 mm, 3 μm, New Objective) using a linear gradient of 2 % to 45 % solvent B (80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Michael H. Myoga, et al.,
bioRxiv - Neuroscience 2023
Quote:
... 3 mm tip-diameter reusable feeding needle (Fine Science Tools), operated using a normally closed pinch valve (NResearch ...
-
No products found
because this supplier's products are not listed.
Jacob W. Myerson, et al.,
bioRxiv - Bioengineering 2020
Quote:
... with separate compartments for each mouse (MPC-3 AERO; Braintree Scientific). To maintain adequate hydration ...
-
No products found
because this supplier's products are not listed.
Frederike Winkel, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and 3) rabbit anti-phospho Kv3.1 (1:100) (#75-041, Phosphosolutions, Aurora, CO) overnight at +4° C ...
-
No products found
because this supplier's products are not listed.
Dmitry Shvarev, et al.,
bioRxiv - Biochemistry 2023
Quote:
... ATTO488-1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (ATTO488) was obtained from ATTO-TEC GmbH (Siegen ...
-
No products found
because this supplier's products are not listed.
Eros Di Giorgio, et al.,
bioRxiv - Cell Biology 2020
Quote:
... n=3 (BJ/E1A-RAS) cells in each well of 96-well plates (Sarstedt). The successful generation of KO clones was screened by immunoblotting and confirmed by Sanger sequencing.
-
No products found
because this supplier's products are not listed.
Boris Bonaventure, et al.,
bioRxiv - Microbiology 2021
Quote:
... or J2 anti-dsRNA antibody (SCICONS), or anti-SARS-CoV-2 Nucleoprotein (N ...
-
No products found
because this supplier's products are not listed.
MU Wagenhäuser, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... specific antibodies were used (Emfret Analytics, GPIb/CD42b ...