-
No products found
because this supplier's products are not listed.
Chenling Xiong, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... 6-well pates (Genesee Scientific, San Diego, CA), or μ-dishes or μ-slide chambers (ibidi ...
-
No products found
because this supplier's products are not listed.
Roberto Frigerio, et al.,
bioRxiv - Biochemistry 2020
Quote:
... anti-CD63-Biotin and anti-CD81-Biotin antibodies (Ancell) 0.1mg/mL for 1 hour ...
-
No products found
because this supplier's products are not listed.
Paprapach Wongdontree, et al.,
bioRxiv - Microbiology 2023
Quote:
... containing 0.5 mM FAs (BHI-FA, with an equimolar mixture of 0.17 mM each C14, C16, C18:1 [Larodan, Sweden]), and BHI-FA containing 10% newborn calf serum (Ser-FA ...
-
No products found
because this supplier's products are not listed.
Yue Wang, et al.,
bioRxiv - Biophysics 2021
Quote:
... 3 μl of purified ghrelin-bound complex at 13 mg/ml and GHRP-6-bound ghrelin receptor complex at 8 mg/ml were applied individually onto a glow-discharged holey carbon grid (Quantifoil, Au300 R1.2/1.3) in a Vitrobot chamber (FEI Vitrobot Mark IV) ...
-
No products found
because this supplier's products are not listed.
Domonique C. Lewis, et al.,
bioRxiv - Plant Biology 2022
Quote:
Fatty acid sodium salts (Na-FA; Nu-Chek Prep, Elysian, MN) were prepared and stored as previously described (Dye ...
-
No products found
because this supplier's products are not listed.
Lu Lv, et al.,
bioRxiv - Biochemistry 2020
Quote:
... D-Biotin (Targetmol, T1116) was added to the transfected cells at a final concentration of 50 μM ...
-
No products found
because this supplier's products are not listed.
Abigael Cheruiyot, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Activity of the SMG1i against other PI3 kinase family members (PI3Kα, PI3Kβ, PI3Kγ, PI3Kδ, MTOR) was evaluated using Amplified Luminescent Proximity Homogeneous Assay (Alpha) Screen assays (Perkin Elmer and Echelon Biosciences). PI3K or mTOR protein (produced in Sf9 cells ...
-
No products found
because this supplier's products are not listed.
NV DiBenedetto, et al.,
bioRxiv - Microbiology 2023
Quote:
... diluted at 4ng/ml in PBS was used for the capture antibodies and the T4G1 monoclonal antibodies previously coupled to biotin were used as detection antibodies (BBI solution, 1:10000 dilution) with streptavidin HRP (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Kerrie L. Marie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Lot# CA36131)/ 1:400 KDEL Receptor 3 (L95) polyclonal (Bioworld Technology Cat# BS3124 ...
-
No products found
because this supplier's products are not listed.
Chow-Seng Kong, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Cells were stained with biotin-labelled HABP primary antibody (AMSBIO, Abington, UK, AMS.HKD-BC41, 1:125) overnight at 4°C and stained with fluorescein-conjugated streptavidin (Vector Laboratories ...
-
No products found
because this supplier's products are not listed.
Chiara E. Geyer, et al.,
bioRxiv - Immunology 2022
Quote:
... IL-6 concentration was determined using antibody pairs from U-CyTech Biosciences (Human IL-6 ELISA ...
-
No products found
because this supplier's products are not listed.
Estere Seinkmane, et al.,
bioRxiv - Cell Biology 2023
Quote:
... while AHA-biotin was detected using Strep-HRP antibody (R-1098-1 from EpiGentek at 1:2000) in 1% BSA ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Daisuke Oikawa, et al.,
bioRxiv - Cell Biology 2021
Quote:
... or M1-TUBE-Biotin (LifeSensors, UM306) with 30 μl of Dynabeads M-280 Streptavidin (Veritas) ...
-
No products found
because this supplier's products are not listed.
Alla Krasikova, et al.,
bioRxiv - Genomics 2023
Quote:
... and either biotin-11-dUTP (Lumiprobe), digoxigenin-11-dUTP (Jena Bioscience ...
-
No products found
because this supplier's products are not listed.
Michael J. Robertson, et al.,
bioRxiv - Biophysics 2022
Quote:
All receptors were expressed in Sf9 insect cells (Expression Systems) infected at a density of 3-4 million cells/ml ...
-
No products found
because this supplier's products are not listed.
Joel E. Graham, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 6 neoprene stoppers (RPI-259100-6) and capped with media bottle lid with a center bore to access the stopper ...
-
No products found
because this supplier's products are not listed.
Anne-Sophie Hafner, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Biotin was detected with a rabbit anti-biotin antibody coupled to 1 nm nanogold particles (1:100, FluoroNanogold Alexa-594, Nanoprobes). Samples were post-fixed in 1% glutaraldehyde in 0.2 mM HEPES pH = 7.2 for 30 min and fixation was quenched with 100 mM Glycine in PBS for 10 min ...
-
No products found
because this supplier's products are not listed.
Rick G. Kim, et al.,
bioRxiv - Plant Biology 2024
Quote:
... Biotinylated peptides were searched using exogenous biotin (ExBio) on lysine as a variable modification ...
-
No products found
because this supplier's products are not listed.
Florian A. Lempp, et al.,
bioRxiv - Microbiology 2021
Quote:
... were transfected with plasmids encoding the following receptor candidates (all purchased from Genecopoeia): ACE2 (NM_021804) ...
-
No products found
because this supplier's products are not listed.
Beatriz Sánchez-Calvo, et al.,
bioRxiv - Plant Biology 2019
Quote:
... Standard solutions of NO2-FA were separated using a reverse phase HPLC column (5µm, 150 × 2.0 mm; Phenomenex) and optimization of mass spectrometer parameters was performed ...
-
No products found
because this supplier's products are not listed.
Leïla Dumas, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... 0.75 mM biotinylated UTP (Biotin-16-UTP, Lucigen BU6105H) and either 7.5 mM GTP or 6.75 mM 7-deazaguanine (TriLink N-1044 ...
-
No products found
because this supplier's products are not listed.
Sandip De, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Cells were pelleted at 6000 rpm for 2 minutes at 4°C and the pellet was resuspended in FA lysis buffer and Zirconia beads (0.7 mm diameter, Biospec). Cells were broken using a cell homogenizer (Bertin Instruments ...
-
No products found
because this supplier's products are not listed.
Simona Miron, et al.,
bioRxiv - Biochemistry 2023
Quote:
... BRCA2 BRC4: Biotin-GSG-IKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ (synthesized by Proteogenix and Genecust) have been measured by BLI using an Octet RED96 instrument (FortéBio ...
-
No products found
because this supplier's products are not listed.
Bijal A. Parikh, et al.,
bioRxiv - Immunology 2019
Quote:
... Fc receptor blocking was performed with 2.4G2 (anti-FcγRII/III) hybridoma (American Type Culture Collection) culture supernatants ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
Weiming Ouyang, et al.,
bioRxiv - Microbiology 2021
Quote:
... S1-biotin (Catalog # 10-208 lot 24598-2003) were obtained from ProSci Inc (Vendor #1 ...
-
No products found
because this supplier's products are not listed.
K. Saini, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 5(6)-CTAMRA (Carbosynth/Novabiochem); TFA (Alfa Aesar) ...
-
No products found
because this supplier's products are not listed.
Agnès Roure, Rafath Chowdhury, Sébastien Darras,
bioRxiv - Developmental Biology 2022
Quote:
... or 2.5 μM of the BMP receptor inhibitor DMH1 (S7146, Euromedex, 10 mM stock solution in DMSO) at the stages indicated in the text and figures ...
-
The Biotin Collagen Hybridizing Peptide (CHP) is a synthetic peptide that can specifically bind...
Cat# 5265-60UG,
0.3 mg, USD $290.0
Ask
Colin D. Paul, et al.,
bioRxiv - Bioengineering 2019
Quote:
Cytosoft 6-well plates (Advanced BioMatrix, San Diego ...
-
No products found
because this supplier's products are not listed.
Natascia Marino, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... and BeadBug 6 homogenizer (Benchmark Scientific) in a cold room at the following conditions ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Holger Dill, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Staining of acetylcholine receptors was performed with 10 µg/ml CF®488A conjugated α-Bungarotoxin (Biotrend, Cologne, Germany) in PBST complemented with 10% FCS and 1% DMSO.
-
No products found
because this supplier's products are not listed.
Martina Oravcová, et al.,
bioRxiv - Cell Biology 2022
Quote:
... arginine-6/lysine-8 (heavy, Cambridge Isotope Laboratories ...
-
No products found
because this supplier's products are not listed.
Duško Lainšček, et al.,
bioRxiv - Immunology 2020
Quote:
... 6-8 kDa cutoff (Spectrum Laboratories, USA). Samples were purified using NiNTA resin (Goldbio ...
-
No products found
because this supplier's products are not listed.
Dong Hun Lee, et al.,
bioRxiv - Physiology 2022
Quote:
... HAPECs (passage 2-6, ScienCell, Carlsbad, CA) were incubated with 0.1 ng/mL interleukin-1 beta (IL-1β) ...
-
No products found
because this supplier's products are not listed.
Allison Sharrar, et al.,
bioRxiv - Biochemistry 2023
Quote:
... C57BL/6 mouse primary hepatocytes (Cell Biologics) were thawed and plated in 96 well tissue culture plates ...
-
No products found
because this supplier's products are not listed.
Christine E. Nelson, et al.,
bioRxiv - Immunology 2022
Quote:
... at a 1:10000 dilution and Goat anti-monkey IgA-Biotin (Alpha Diagnostic International #70049) at a 1:5,000 dilution in Dilution Buffer was added ...
-
No products found
because this supplier's products are not listed.
Xiuqing Han, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... tumor necrosis factor α (TNF-α) and TATA box binding protein (TBP) were determined by real☐time PCR (ABI 7900 Prism, Applied Biosystems, US). Sequences used to amplify a fragment of IL-6 were FP ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Yurika Matsui, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Resolving gels: 6-12% ProtoGel (National Diagnostics EC8901LTR), 0.375 M Tris-HCl (pH 8.8) ...
-
No products found
because this supplier's products are not listed.
Chieko Goto, et al.,
bioRxiv - Plant Biology 2019
Quote:
... 6 were obtained using a confocal laser scanning microscope (LSM780; Carl Zeiss). The 405 nm line of a blue diode laser ...
-
No products found
because this supplier's products are not listed.
Alejandro Jiménez-González, et al.,
bioRxiv - Microbiology 2024
Quote:
... we added 6 µL of rDNAse buffer and 0.6 µL rDNAse (Macherey-Nagel) per sample and incubated at 37°C for 10 min ...
-
No products found
because this supplier's products are not listed.
Jae Yeong Ha, et al.,
bioRxiv - Pathology 2023
Quote:
... Tissue samples were analyzed using the ELISA kits for IL-6 (KET7009; Abbkine, Wuhan, China) and TNF-α (ADI-900- 047 ...
-
No products found
because this supplier's products are not listed.
Chongping Li, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and goat anti-mouse IgG secondary antibody (L3032, Signalway Antibody).
-
No products found
because this supplier's products are not listed.
Farès Ousalem, et al.,
bioRxiv - Microbiology 2023
Quote:
... an HRP-conjugated antibody (Anti-rabbit IgG, antibody [HRP] from COVALAB) diluted 20,000x in PBS was used ...
-
No products found
because this supplier's products are not listed.
Roy G. Muriu, Jessica M. Sage, Abdulbaki Agbas,
bioRxiv - Neuroscience 2019
Quote:
... MBL antibodies (MBL International, 15A Constitution way ...
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Katharina Hutter, et al.,
bioRxiv - Immunology 2022
Quote:
... Bound antibodies were visualized with HRP-labeled secondary antibodies and the ECL system (Advansta) on a light-sensitive film (Amersham ...
-
No products found
because this supplier's products are not listed.
Martin Privat, et al.,
bioRxiv - Neuroscience 2024
Quote:
... the primary antibody used was a rabbit anti-GFP antibody (TP401, Torrey pines biolabs) diluted 1:1000 in blocking buffer for overnight incubation ...
-
No products found
because this supplier's products are not listed.
Bjoern Traenkle, et al.,
bioRxiv - Immunology 2021
Quote:
... M13-HRP-labeled antibody (Progen) was added at a conc ...