-
No products found
because this supplier's products are not listed.
Elisangela Bressan, et al.,
bioRxiv - Genomics 2023
Quote:
... Primary antibodies were applied overnight at 4°C and included TH (Pel-Freez Biologicals #P40101 and Merck Millipore #AB9702 ...
-
No products found
because this supplier's products are not listed.
Nadezda A. Fursova, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Antibody-bound nucleosomes were captured for 1 hr at 4°C using protein A agarose (Repligen) beads ...
-
No products found
because this supplier's products are not listed.
Wu Liu, et al.,
bioRxiv - Microbiology 2019
Quote:
... 2’-C-methyladenosine (2’-C-Me-A) was obtained from Carbosynth Limited (Compton ...
-
No products found
because this supplier's products are not listed.
Thibault Legal, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Cheeseman, 1: 1000), guinea pig CENP-C (pAb, MBL PD030, 1:2000) and human ACA antibodies (Cambridge Biosciences, 1:100). Hoechst 33342 (ThermoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Brittany Johnson, et al.,
bioRxiv - Biochemistry 2023
Quote:
... a mouse monoclonal antibody against c-Myc purified from the culture medium of hybridoma clone 9E10 (American Type Culture Collection) Mouse monoclonal anti-T7 tag IgG was obtained from EMD Biosciences (San Diego ...
-
No products found
because this supplier's products are not listed.
Yongsung Kim, et al.,
bioRxiv - Genomics 2024
Quote:
42 °C Incubator (Boekel Scientific™ model no ...
-
No products found
because this supplier's products are not listed.
Danielle L. Michell, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... and incubated overnight with rocking at 4°C with anti-human apoA-I primary antibody (mouse monoclonal, 1:8000, Meridian Life Sciences). Membranes were washed 3X for 10min with 1X TBS-T (0.1% Tween 20 ...
-
No products found
because this supplier's products are not listed.
Thanh Ngoc Nguyen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... equipped with a 45 °C diamond knife (Diatome) was used to section the resin embedded samples ...
-
No products found
because this supplier's products are not listed.
Lisa-Marie Appel, et al.,
bioRxiv - Biochemistry 2022
Quote:
Crystalization was performed at at 22°C or 4°C using a sitting-drop vapour diffusion technique and micro-dispensing liquid handling robot Mosquito (TTP labtech). The best diffracting crystals of SHARP SPOC:1xS5P CTD were grown at 22°C in conditions E9 from ShotGun HT screen (SG1 HT96 Molecular Dimensions ...
-
No products found
because this supplier's products are not listed.
Sourav Roy, et al.,
bioRxiv - Microbiology 2023
Quote:
... ELISAs specific for the lectin pathway contained single 1 μM concentrations of FbpC-C or BBK32-C incubated with 2% C1q-depleted NHS (Complement Technologies). Serum incubations were performed in complement ELISA buffer (10 mM HEPES pH 7.3 ...
-
No products found
because this supplier's products are not listed.
Pierre Barraud, et al.,
bioRxiv - Molecular Biology 2019
Quote:
All in vitro NMR spectra of yeast tRNAPhe were measured at either 38°C or 30°C on Bruker AVIII-HD 600 MHz and AVIII-HD 700 MHz spectrometers (equipped with TCI 5-mm cryoprobes) with 5-mm Shigemi tubes ...
-
No products found
because this supplier's products are not listed.
Oksana Y. Dudaryeva, et al.,
bioRxiv - Bioengineering 2021
Quote:
... by dialysis at 4 °C (1000 g mol-1 MWCO; Spectrum Laboratories), 4 times 6 h ...
-
No products found
because this supplier's products are not listed.
Soon-Gook Hong, et al.,
bioRxiv - Cell Biology 2023
Quote:
... for 20 min at 37°C with Hoechst 33342 (AAT Bioquest #17535).
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Katja Baur, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or incubated at 37°C overnight in 1 ml Euromed-N (Euroclone, #ECM0883L) containing 2% B27 (Invitrogen ...
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Katharina Hutter, et al.,
bioRxiv - Immunology 2022
Quote:
... Bound antibodies were visualized with HRP-labeled secondary antibodies and the ECL system (Advansta) on a light-sensitive film (Amersham ...
-
No products found
because this supplier's products are not listed.
NV DiBenedetto, et al.,
bioRxiv - Microbiology 2023
Quote:
... diluted at 4ng/ml in PBS was used for the capture antibodies and the T4G1 monoclonal antibodies previously coupled to biotin were used as detection antibodies (BBI solution, 1:10000 dilution) with streptavidin HRP (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Amanda N. Scholes, Jeffrey A. Lewis,
bioRxiv - Genomics 2019
Quote:
... and then placed in a 65°C preheated Multi-Therm incubated vortexer (Benchmark Scientific) at 1500 rpm for 45 minutes ...
-
No products found
because this supplier's products are not listed.
Shan Jiang, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... The protein standard with the C-terminal FLAG tag (E-PKSH032870.10) was from Biomol. Linear DNA templates were produced by PCR and were PCR purified ...
-
No products found
because this supplier's products are not listed.
Chao Wang, et al.,
bioRxiv - Cell Biology 2019
Quote:
... anti-mouse-HRP antibody (ImmunoVision Technologies) was added and the cells were incubated with the secondary antibody for 2 hrs ...
-
No products found
because this supplier's products are not listed.
MU Wagenhäuser, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... specific antibodies were used (Emfret Analytics, GPIb/CD42b ...
-
No products found
because this supplier's products are not listed.
Liam Hudson, et al.,
bioRxiv - Biochemistry 2023
Quote:
... C-His tagged IDH1 R132H (Met1-Leu414) was purchased from G-Biosciences (BAN1708, 50 µg). N-His and GST tagged USP7 (Lys208-Glu560 ...
-
No products found
because this supplier's products are not listed.
Diego Y. Grinman, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... Five percent sucrose water or placebo pellets (15mg/pellet; Cat# C-111, Innovative Research of America) were used as controls ...
-
No products found
because this supplier's products are not listed.
Sushant Bhat, et al.,
bioRxiv - Microbiology 2021
Quote:
... (ID Vet) and Influenza A Antibody ELISA (IDEXX) were performed according to manufacturers’ instructions.
-
No products found
because this supplier's products are not listed.
Marissa Lindman, et al.,
bioRxiv - Immunology 2023
Quote:
... IFNAR-1 monoclonal antibody (MAR1-5A3, Leinco Technologies) or isotype control (GIR-208 ...
-
No products found
because this supplier's products are not listed.
Chloé Cathebras, et al.,
bioRxiv - Plant Biology 2022
Quote:
... Orthologs of the whole NLP family were retrieved using tBLASTn v2.11.0+ (Camacho et al., 2009) with reference sequences from Medicago truncatula as query and a cut-off e-value of 1e-10 ...
-
No products found
because this supplier's products are not listed.
Eivind Heggernes Ask, et al.,
bioRxiv - Immunology 2023
Quote:
Cells were stained with Cell-ID Intercalator-Rh (Fluidigm, San Francisco, CA) and GLUT1.RBD.GFP (Metafora Biosystems, Evry cedex, France) according to the manufacturer’s instructions to allow for viability testing and GLUT-1 detection ...
-
No products found
because this supplier's products are not listed.
Ignasi Casanellas, et al.,
bioRxiv - Bioengineering 2021
Quote:
... immunostained with anti-C×43 antibody and Sir-Actin (Tebu-bio, SC001), and imaged with a Zeiss LSM780 Confocal Microscope (Zeiss Microscopy ...
-
No products found
because this supplier's products are not listed.
Kartikeya Vijayasimha, et al.,
bioRxiv - Immunology 2022
Quote:
... Transfected cells were allowed to recover for two days and were then labelled at 4°C with anti-Thy1.1 antibody (clone HIS51, eBiosciences) for 30 minutes in PBS buffer containing 0.1% BSA (Amresco). Cells were then washed in buffer and incubated with anti-mouse IgG microbeads beads (Miltenyi Biotech ...
-
No products found
because this supplier's products are not listed.
Kevin M. Knox, et al.,
bioRxiv - Neuroscience 2021
Quote:
... FluoroJade-C (FJ-C; catalog #1FJC) was from Histo-Chem Inc (Jefferson ...
-
No products found
because this supplier's products are not listed.
Benjamin R. Babcock, et al.,
bioRxiv - Systems Biology 2021
Quote:
... A maximum of 1×106 cells/donor were stained by oligo-barcoded antibodies (TotalSeq-A or TotalSeq-C; Biolegend, Expedeon) for 30 min on ice ...
-
No products found
because this supplier's products are not listed.
Barbara Ciralli, et al.,
bioRxiv - Neuroscience 2023
Quote:
... cannabinol (Cerilliant C-046) and CBD (Cerilliant C-045 ...
-
No products found
because this supplier's products are not listed.
Elizabeth J Glover, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Permeabilization was enhanced by incubation in 0.4% Triton-X in PBS followed by incubation in primary antibodies in PBS containing 0.2% Triton-X overnight at 4 °C (CtB 1°: 1:500, List Biological Laboratories #703 ...
-
No products found
because this supplier's products are not listed.
Samuel K. Powell, et al.,
bioRxiv - Genomics 2023
Quote:
... and incubated overnight at 4 °C with primary antibodies in 5% donkey serum and 0.1% Tween-20 (Boston BioProducts, #IBB-181X) in PBS ...
-
Glenzocimab (Anti-GP6 / Glycoprotein-6) is a Fab fragment of humanized anti-GPVI monoclonal...
Cat# A2478, SKU# A2478-1mg,
1mg, $370.00
Ask
Georgia Balsevich, et al.,
bioRxiv - Neuroscience 2022
Quote:
... and Compound C (Selleck Chemicals, S7306), were used in all in vitro and in vivo experiments ...
-
No products found
because this supplier's products are not listed.
Atul Rangadurai, et al.,
bioRxiv - Biophysics 2021
Quote:
... 13C/15N labeled C (Cambridge Isotope Laboratories), 13C C2 and C8 labeled rm6A (67) ...
-
No products found
because this supplier's products are not listed.
Luisa de Lemos, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Fluoro-Jade C labelling was performed on retinal organoids cryosections using the Fluoro-Jade® C staining kit (Biosensis) and following the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Bo Fan, et al.,
bioRxiv - Bioengineering 2020
Quote:
... post-baked (65 °C and 95 °C for 1 min and 4 min, respectively) and developed in SU-8 developer (MicroChem). The SU-8 was hard-baked at 180 °C for 1 hour after development ...
-
No products found
because this supplier's products are not listed.
Katherine C. Woronowicz, et al.,
bioRxiv - Evolutionary Biology 2023
Quote:
... 8°C) and Covaris microTUBE Snap-Cap tubes (Covaris 520045). Sequencing libraries were produced using the KAPA HyperPrep Kit (Roche 07137923001 ...
-
No products found
because this supplier's products are not listed.
Rebecca O’Cleirigh, Roslyn Gibbs,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... and incubated at 37°C and 5% CO2 (Nuaire, DH Autoflow). Media was changed every 48 hours and cells passaged when they reached confluence as recommended by the supplier ...
-
No products found
because this supplier's products are not listed.
Priyanka Chatterjee, et al.,
bioRxiv - Microbiology 2024
Quote:
... Escherichia coli strains were grown at 37°C in NZCYM (RPI) medium supplemented with ampicillin (100 µg mL-1 final ...
-
No products found
because this supplier's products are not listed.
Yanisa Anaya, et al.,
bioRxiv - Immunology 2024
Quote:
... secondary antibody (Goat-Anti-Rabbit Secondary Antibody, Protein Simple, Cat-No. 040-656), and performed the necessary washing steps between incubations ...
-
No products found
because this supplier's products are not listed.
Katelyn A. Bustin, et al.,
bioRxiv - Neuroscience 2023
Quote:
... (Bullet Blender, BBY24M model, Next Advance, Inc., speed 8, 3 min, 4 °C), samples were diluted in PBS (500 μL ...
-
No products found
because this supplier's products are not listed.
M. Martinez, et al.,
bioRxiv - Microbiology 2023
Quote:
... at 4°C and loaded 3 times in a CellD disrupter (Constant Systems). The lysate was centrifuged for 15min at 12000 x g at 4°C to remove cell debris and the supernatant was centrifuged again for 1h at 100000 x g at 4°C ...
-
No products found
because this supplier's products are not listed.
Joshua A. Beitchman, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Body temperature was maintained at 37 °C with isothermal heating pads (Braintree Scientific, MA). A midline incision was made in which the skin ...
-
No products found
because this supplier's products are not listed.
Mastura Akter, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Stainless steel guide cannulae (Double/O.D.0.41mm-27G/C, cat # 62069, RWD life science.com.ltd.) were bilaterally positioned into ACC region (2.4 mm anterior to bregma and 0.5 mm lateral from midline ...
-
No products found
because this supplier's products are not listed.
Yann Aquino, et al.,
bioRxiv - Genomics 2022
Quote:
... mouse monoclonal antibody (PBL Assay Science) was used to coat paramagnetic beads at a concentration of 0.3 mg/mL ...
-
No products found
because this supplier's products are not listed.
Koji Ishikawa, Akari Ishihara, Hisao Moriya,
bioRxiv - Genetics 2019
Quote:
... and peroxidase-conjugated secondary antibody (Nichirei Biosciences) (1:1,000 ...
-
No products found
because this supplier's products are not listed.
Molly C. McCloskey, et al.,
bioRxiv - Bioengineering 2022
Quote:
... 20°C with equivalent volumes of 1-Step Polymorphs solution (Accurate Chemical & Scientific Co, Westbury, NY). Following centrifugation ...
-
No products found
because this supplier's products are not listed.
Katharina Ziegler, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Slices were maintained at 24±1 °C using a dual TC344B temperature control system (Sutter Instruments). S1HL slices were continuously perfused with oxygenated (95%O2/ 5%CO2 ...