-
No products found
because this supplier's products are not listed.
Stacia M. Nicholson, Francis A.X. Schanne,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
Recombinant mouse TNFSF11 (IBI Scientific, Indiana), also known as RANKL ...
-
No products found
because this supplier's products are not listed.
Elena Arutyunova, et al.,
bioRxiv - Biophysics 2021
Quote:
... The fusion protein was subsequently digested with His-tagged SUMO protease (McLab, South San Francisco, CA) at 4 °C for 1–2 h to remove the SUMO tag and the resulting cleavage mixture was then passed through Ni-NTA resin column ...
-
No products found
because this supplier's products are not listed.
Fabian Link, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Transferrin-gold (Cytodiagnostics) or BSA-gold (Alexa555-BSA-Au ...
-
No products found
because this supplier's products are not listed.
Natasha Ting Lee, et al.,
bioRxiv - Neuroscience 2023
Quote:
Recombinant mouse t-PA (0.9 mg/kg; Molecular Innovations, MI, USA) or saline (equi-volume ...
-
No products found
because this supplier's products are not listed.
Céline Christiansen, et al.,
bioRxiv - Microbiology 2022
Quote:
... 5 µg/ml human holo-transferrin (PAN Biotech) and 1.7 ng/µl sodium selenite (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Sameh S. M. Soliman, et al.,
bioRxiv - Microbiology 2021
Quote:
Rabbit and mouse monoclonal antibodies against recombinant mucoricin coupled to KLH were raised by ProMab Biotechnologies Inc.11 ...
-
No products found
because this supplier's products are not listed.
Liangxi Wang, et al.,
bioRxiv - Genomics 2022
Quote:
... Cells were then treated with 10 ng/mL recombinant mouse TNFα (Cell Applications, cat# RP2031-20) for 45 min in basal Endothelial Cell Growth Media MV2 (PromoCell ...
-
No products found
because this supplier's products are not listed.
Peter Hanna, et al.,
bioRxiv - Neuroscience 2020
Quote:
... A quadripolar His catheter (Abbott) was placed via the right external jugular vein and advanced until a His signal was visualized while a quadripolar catheter was inserted via the right femoral vein and advanced to the right atrium ...
-
No products found
because this supplier's products are not listed.
Nanami Sakata, et al.,
bioRxiv - Plant Biology 2022
Quote:
... L-His (Tokyo Chemical Industry), and L-Lys (Nacalai tesque ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Siran Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
No products found
because this supplier's products are not listed.
June-Hyung Kim, et al.,
bioRxiv - Immunology 2019
Quote:
... In vitro ubiquitination of Asc was performed by incubating 300 ng of mouse recombinant Asc (CSB-EP861664MO, CUSABIO, Tx, USA), 1 µg of recombinant Mul1 ...
-
No products found
because this supplier's products are not listed.
Matthew J. Stevenson, et al.,
bioRxiv - Cancer Biology 2022
Quote:
DNA sequences flanked by XhoI and NdeI restriction sites and encoding for N-terminal GST-tagged-SIX1 or N-terminal GST-tagged-SIX1-Q177R homeodomains were synthesized by Integrative DNA Technologies (IDT) as gBlocks (Supplemental Table 2) ...
-
No products found
because this supplier's products are not listed.
Huang Zhu, Dan S. Kaufman,
bioRxiv - Immunology 2019
Quote:
... 15 % heat-inactivated human AB serum (Valley Biomedical, Catalog # HP1022 HI),1 % P/S ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
Ben S. Ou, et al.,
bioRxiv - Bioengineering 2023
Quote:
... HIS Lite Cy3 Bis NTA-Ni Complex was purchased from AAT Bioquest. Unless otherwise stated ...
-
No products found
because this supplier's products are not listed.
Advika Kamatar, et al.,
bioRxiv - Biophysics 2023
Quote:
... His-Clathrin was labeled with Atto594 NHS-ester (ATTO-TEC, Sigma-Aldrich) according to a previously published protocol (41 ...
-
No products found
because this supplier's products are not listed.
Ben S. Ou, et al.,
bioRxiv - Immunology 2023
Quote:
... Heat Inactivated fetal bovine serum (HI-FBS) was purchased from Atlanta Biologicals. IFN-α cytokine enzyme-linked immunosorbent assay (ELISA ...
-
No products found
because this supplier's products are not listed.
Shaun M. Christie, et al.,
bioRxiv - Biophysics 2021
Quote:
... Recombinant human Semaphorin 3A (CX65, Bon Opus Biosciences, Milburn, NJ) contains residues 21-771 and is >95% pure ...
-
No products found
because this supplier's products are not listed.
Kathryn L. Wofford, et al.,
bioRxiv - Bioengineering 2019
Quote:
... either human recombinant myelin basic protein (Alfa Aesar, cat. #AAJ66051LB0) fluorescently labeled with Vybrant DiD (Molecular Probes ...
-
No products found
because this supplier's products are not listed.
Kenji Shimada, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... then 0.002 U of recombinant hOGG1 (Trevigen, 4130-100-E) was added to one sample and further incubated for 30 min at 37°C ...
-
No products found
because this supplier's products are not listed.
Nathan J. Dwarshuis, et al.,
bioRxiv - Bioengineering 2019
Quote:
The anti-CD19-CD8-CD137-CD3z chimeric antigen receptor with the EF1α promotor [28] was synthesized (Aldevron) and subcloned into a FUGW lentiviral transfer plasmid (Emory Viral Vector Core) ...
-
No products found
because this supplier's products are not listed.
Agnès Roure, Rafath Chowdhury, Sébastien Darras,
bioRxiv - Developmental Biology 2022
Quote:
... or 2.5 μM of the BMP receptor inhibitor DMH1 (S7146, Euromedex, 10 mM stock solution in DMSO) at the stages indicated in the text and figures ...
-
No products found
because this supplier's products are not listed.
Marisa Oliveira, et al.,
bioRxiv - Immunology 2020
Quote:
... and chicken interferon alpha (Yeast-derived Recombinant Protein, Kingfisher Biotech, Inc) were diluted in nuclease-free water (Ambion ...
-
No products found
because this supplier's products are not listed.
Melisa Lázaro, et al.,
bioRxiv - Microbiology 2020
Quote:
... This was confirmed by labeling N-terminally His6-tagged mL-GDH180 with Ni-NTA-Nanogold (Nanoprobes) and visualizing particles by negative staining electron microscopy ...
-
No products found
because this supplier's products are not listed.
Rachael Kuintzle, et al.,
bioRxiv - Systems Biology 2023
Quote:
... All of the Notch receptor piggyBac constructs were derived from the vector PB-CMV-MCS-EF1-Puro (System Biosciences), with changes made to the promoter (CMV changed to PGK or CAG ...
-
No products found
because this supplier's products are not listed.
Laura Pezzè, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... Recombinant human IFN-β and IFN-γ (Peprotech, Tebu-Bio, Milan, Italy) were used at different concentrations and for different time points based on the experiment ...
-
No products found
because this supplier's products are not listed.
Wiktoria Ogrodzińska, et al.,
bioRxiv - Biochemistry 2024
Quote:
... The recombinant plasmids were isolated using plasmid purification kit (Bio Basic Canada) and the inserts were verified by sequencing (Genomed ...
-
No products found
because this supplier's products are not listed.
Nicolas Lamassiaude, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... Recombinant constructs were purified using EZNA Plasmid DNA Mini kit (Omega Bio-Tek) and sequence-checked (Eurofins Genomics) ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
R. Chittajallu, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Glutamate receptor mediated synaptic responses (EPSCs and EPSPs) were evoked with A360 constant-current stimulus isolator (World Precision Instruments, Sarasota, FL, USA) and with stimulation electrodes pulled from borosilicate glass filled with aCSF placed in SLM in the presence 50μM picrotoxin ...
-
No products found
because this supplier's products are not listed.
Aruna Pal, Abantika Pal, Pradyumna Baviskar,
bioRxiv - Genomics 2020
Quote:
... Gene fragment insert in the recombinant plasmid was sequenced by an automated sequencer (ABI prism) using the dideoxy chain termination method with T7 and SP6 primers (Chromous Biotech ...
-
No products found
because this supplier's products are not listed.
Charles A. Specht, et al.,
bioRxiv - Immunology 2021
Quote:
... the recombinant proteins were resolved on SDS-PAGE and stained with Coomassie InstantBlue (Expedeon, Ltd.).
-
No products found
because this supplier's products are not listed.
Asano Watanabe, et al.,
bioRxiv - Cell Biology 2021
Quote:
... GFP-tagged human vWF plasmid (Romani de Wit et al., 2003) was kindly provided by Jan Voorberg (Stichting Sanquin Bloedvoorziening, Netherland) under Materials Transfer Agreement ...
-
No products found
because this supplier's products are not listed.
Jonathan M Downie, et al.,
bioRxiv - Genetics 2019
Quote:
... HEK293T cells were incubated in high glucose Dulbecco’s Modified Eagle’s Medium (DMEM) supplemented with 10% heat inactivated fetal bovine serum (HI FBS, Genesee Scientific), and 1% pen/strep (P/S ...
-
No products found
because this supplier's products are not listed.
Nandan Haloi, et al.,
bioRxiv - Biophysics 2020
Quote:
... followed by addition of HKII (human recombinant HKII, 60 kU/ml; Genway Biotech, Slan Diego, CA) into the cis chamber ...
-
No products found
because this supplier's products are not listed.
Jiechao Zhou, et al.,
bioRxiv - Neuroscience 2022
Quote:
... mouse sera (Complement Technology) was incubated with C1q (4.8 ...
-
No products found
because this supplier's products are not listed.
Thaís Del Rosario Hernández, et al.,
bioRxiv - Animal Behavior and Cognition 2023
Quote:
... The cages also contained a transparent red mouse house (Bio-Serv, mouse arch, red) and a transparent 7-sided pill box for food and water (Amazon ...
-
No products found
because this supplier's products are not listed.
Roya Yousefi, et al.,
bioRxiv - Biochemistry 2020
Quote:
... ANK-G (mouse, Antibodies incorporated), SYP (guinea pig ...
-
No products found
Richard J. Roller, et al.,
bioRxiv - Microbiology 2021
Quote:
... or mouse anti-VP5 (Biodesign. International) 1:500 ...
-
No products found
because this supplier's products are not listed.
Xiaodan Zhang, et al.,
bioRxiv - Genomics 2021
Quote:
... anti-mouse Lyve1 antibody (1:100, AngioBio cat.no ...
-
No products found
because this supplier's products are not listed.
Rita R. Fagan, et al.,
bioRxiv - Neuroscience 2020
Quote:
... mouse anti-SERT (ST51-2; Mab Technologies), rabbit anti-HA (C29F4 ...
-
No products found
because this supplier's products are not listed.
Qian Xue, et al.,
bioRxiv - Cell Biology 2022
Quote:
... mouse anti-mCherry (Encor Biotechnology, MCA-1C51), rabbit anti-pY118 Paxillin (Novus Biologicals ...
-
No products found
because this supplier's products are not listed.
Jiechao Zhou, et al.,
bioRxiv - Neuroscience 2022
Quote:
... C1q mouse ELISA (Hycult Biotech, HK211-01), Total C4 (LSBio ...
-
No products found
because this supplier's products are not listed.
Jasmin N. Beaver, et al.,
bioRxiv - Neuroscience 2023
Quote:
... all mouse cages contained Nestlets (Ancare, Bellmore, NY) and huts ...
-
No products found
because this supplier's products are not listed.
Eleni Kafkia, et al.,
bioRxiv - Systems Biology 2020
Quote:
... mouse anti-lamin B1 (1:500, Atlas Antibodies, AMAb91251) and anti-mouse Alexa Fluor 555 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Gokul Swaminathan, et al.,
bioRxiv - Immunology 2021
Quote:
... following the Mouse Anti-OVA IgG Antibody Assay Kit (Chondrex), or as previously described (76).
-
No products found
because this supplier's products are not listed.
Jean-Philippe Corre, et al.,
bioRxiv - Pathology 2022
Quote:
... platelets using DyLight488-anti-mouse GPIbβ antibody (0.1 μg, #X488, Emfret Analytics) and fibrin deposits using DyLight488-anti-human/mouse fibrin antibody (8 μg ...
-
No products found
because this supplier's products are not listed.
Seraina A. Domenig, et al.,
bioRxiv - Cell Biology 2023
Quote:
... at 37°C using DirectPCR Lysis Reagent (mouse tail) (VIG102-T, Viagen Biotech). PCR for Pax7-nGFP was performed using primer Pax7nGFP.F/ Pax7nGFP.R and GoTaq G2 Hot Start Green Master Mix (M7423 ...
-
No products found
because this supplier's products are not listed.
Marc Schwab, et al.,
bioRxiv - Neuroscience 2020
Quote:
... As a detection system the Simple Stain MAX PO (MULTI) anti-mouse (Nichirei Biosciences) was used ...