-
No products found
because this supplier's products are not listed.
Shaun M. Christie, et al.,
bioRxiv - Biophysics 2021
Quote:
... Recombinant human Semaphorin 3A (CX65, Bon Opus Biosciences, Milburn, NJ) contains residues 21-771 and is >95% pure ...
-
No products found
because this supplier's products are not listed.
In-Hyuk Jung, et al.,
bioRxiv - Genetics 2020
Quote:
... 50 µg ml-1 human medium oxidized low density lipoprotein (oxLDL, #770202-7, Kalen biomedical) was used.
-
No products found
because this supplier's products are not listed.
Joseph E Kaserman, et al.,
bioRxiv - Cell Biology 2022
Quote:
Secreted total AAT was quantified from iHep supernatants using the human alpha-1-antitrypsin ELISA quantification kit (GenWay Biotech) per manufacturer’s instructions ...
-
Human Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) Protein is a recombinant protein...
Cat# abx680054-1UG,
1 µg USD $261.0
Ask
Isabel Brandão, et al.,
bioRxiv - Physiology 2023
Quote:
... or after the primary antibody was incubated with recombinant Human Peroxidasin Homolog Protein (Abbexa; catalog # abx068474), in equimolar (1:1 ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Roland Immler, et al.,
bioRxiv - Immunology 2020
Quote:
... secondary goat anti mouse-PE (Pharmingen),mouse anti human CD18 high affinity confirmation (clone 24, Hycult Biotech, 10μg/ml), mouse anti human CD18 extended confirmation (clone KIM127 ...
-
No products found
because this supplier's products are not listed.
Vincent Soubannier, et al.,
bioRxiv - Neuroscience 2019
Quote:
... human iPSC-derived astrocytes were incubated with tumour necrosis factor alpha (TNFa) (30 ng/ml; Cell Sciences; Newburyport, MA; Cat. No. CRT100B), interleukin alpha (IL-1a ...
-
No products found
because this supplier's products are not listed.
Zane Kliesmete, et al.,
bioRxiv - Evolutionary Biology 2022
Quote:
... Primary antibodies (chicken alpha-GFP, Aves Labs: GFP-1010 and rabbit alpha-Ki67 ...
-
CDH18 is expressed specifically in the central nervous system and is putatively involved in...
Cat# 5090-0.1MG,
0.1 mg, USD $235.0
Ask
M. E. Torki, Z. Chen, F. Liu,
bioRxiv - Cell Biology 2023
Quote:
... and embedded in low-density (1.66 mg/mL) and mid-density (3 mg/mL) bovine collagens (PureCol, Advanced Biomatrix) [65] ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Carlo Dal Lin, et al.,
bioRxiv - Cell Biology 2020
Quote:
... mouse anti-alpha-tubulin (α-tubulin) (EXBIO Praha, Czech Republic) diluted 1:500 ...
-
Glutathione Colorimetric Detection (200 Low Cuvettes) - assay Kit
Cat# K006-H1C-L,
1.0 ea, USD $430.0
Ask
Nina Kessler, et al.,
bioRxiv - Immunology 2022
Quote:
cGAMP in human PBMCs was quantified with the 2’,3’-Cyclic GAMP ELISA Kit (Arbor assays) according to the manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Sanjay Srivatsan, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... with low retention tips (Rainin 17014402) with or without 5 μL of Proteinase K (Thermo Fisher A42363 ...
-
No products found
because this supplier's products are not listed.
Matthew J. Stevenson, et al.,
bioRxiv - Cancer Biology 2022
Quote:
DNA sequences flanked by XhoI and NdeI restriction sites and encoding for N-terminal GST-tagged-SIX1 or N-terminal GST-tagged-SIX1-Q177R homeodomains were synthesized by Integrative DNA Technologies (IDT) as gBlocks (Supplemental Table 2) ...
-
No products found
because this supplier's products are not listed.
Miguel Alejandro Lopez-Ramirez, et al.,
bioRxiv - Biochemistry 2019
Quote:
... Low volume dispensing plates (Labcyte #LP-0200) were assembled using an Agilent BioCell work station (Santa Clara ...
-
No products found
because this supplier's products are not listed.
Jennifer David-Bercholz, et al.,
bioRxiv - Neuroscience 2022
Quote:
... using low-binding pipette tips (Genesee Scientific) and stored at −80°C before analysis ...
-
No products found
because this supplier's products are not listed.
Drake A. Russell, et al.,
bioRxiv - Biochemistry 2022
Quote:
... and 2,3-dichloro-alpha-methylbenzylamine was sourced from Enamine (Monmouth Jct., NJ). Reagents and materials for E ...
-
No products found
because this supplier's products are not listed.
Anil H. Kadam, et al.,
bioRxiv - Bioengineering 2022
Quote:
... recombinant hu TGF-β1(ProSci, Poway, CA), anti-TGF-β1 IgY-Biotin (R&D Systems ...
-
No products found
because this supplier's products are not listed.
Awadhesh Kumar Verma, et al.,
bioRxiv - Biophysics 2022
Quote:
... For this we have used Raman-AFM Microscope alpha 300 RA (Oxford Instruments). The time-resolved fluorescence measurement of PVA Capped ZnO and PVP capped ZnO in the absence and presence of antibiotics was recorded at 360 nm emission wavelength using Time Resolved Fluorescence Spectrometer (TRFS ...
-
No products found
because this supplier's products are not listed.
Dennis J Doorduijn, et al.,
bioRxiv - Immunology 2019
Quote:
... Nunc Maxisorp ELISA plates were coated overnight at 4 °C with 50 µl/well of 3 µg/ml monoclonal mouse IgG1 anti human C6 (Quidel) in PBS ...
-
No products found
because this supplier's products are not listed.
Julia A Alvarez, et al.,
bioRxiv - Microbiology 2024
Quote:
... 20% heat inactivated (HI) fetal bovine serum (FBS) (Omega Scientific), 1% penicillin-streptomycin (Life Technologies ...
-
No products found
because this supplier's products are not listed.
Jan-Renier A.J. Moonen, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Flag-tagged KLF4 (#VH829440, Vigene Biosciences) or GFP control (AVP004, GenTarget Inc) for 12 h after which cells were allowed to recover for 90 h before being harvested for subsequent experiments.
-
No products found
because this supplier's products are not listed.
William S. Lawrence, et al.,
bioRxiv - Microbiology 2023
Quote:
... Biotinylated recombinant PA83 (List Biological Labs, Campbell, CA) was bound to streptavidin-coated plates (MesoScale Discovery ...
-
No products found
because this supplier's products are not listed.
Yong Li, et al.,
bioRxiv - Cell Biology 2020
Quote:
... and homogenized at a relatively low speed (T10, IKA). The resulting suspension was centrifuged at 600 x g for 2.5 min at 4°C and washed three times in relaxing solution ...
-
No products found
because this supplier's products are not listed.
Tylor R. Lewis, et al.,
bioRxiv - Cell Biology 2023
Quote:
... embedded in 2.5% low-melt agarose (Precisionary, Greenville, NC) and cut into 200 µm thick slices on a Vibratome (VT1200S ...
-
No products found
because this supplier's products are not listed.
Randy Yoo, et al.,
bioRxiv - Biochemistry 2023
Quote:
... 96-well plate low volume crystallization plates (Hampton Research) were all set up at room temperature using sitting drop method with ratios 1:1 and 1:2 for precipitant to protein ...
-
No products found
because this supplier's products are not listed.
Carolina Flores-Muñoz, et al.,
bioRxiv - Neuroscience 2021
Quote:
... low-pass filtered (1700 Differential AC Amplifier, A-M Systems), and then digitized (NI PCI-6221 ...
-
No products found
because this supplier's products are not listed.
Joseph J. Maciag, et al.,
bioRxiv - Microbiology 2023
Quote:
... and 14-20% BCS PEG SMEAR Low (Molecular Dimensions, CalibreScientific). Crystals were added to a cryoprotectant consisting of 80% mother liquor and 20% MPD prior to being flash frozen in liquid nitrogen ...
-
No products found
because this supplier's products are not listed.
Marie Synakewicz, et al.,
bioRxiv - Biophysics 2019
Quote:
... The soluble protein fraction was applied to glutathione resin (Amintra Affinity Resins, Expedeon) equilibrated in lysis buffer ...
-
No products found
because this supplier's products are not listed.
Linda Su-Feher, et al.,
bioRxiv - Neuroscience 2021
Quote:
Low-magnification epifluorescent images were taken using a Coolsnap camera (Photometrics) mounted on a Nikon Eclipse 80i microscope using NIS Elements acquisition software (Nikon ...
-
No products found
because this supplier's products are not listed.
Álvaro Inglés-Prieto, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Transgenic flies expressing Opto-dRET and Opto-dRETMEN2B were generated by injection of pUAST receptor constructs (BestGene). For selection ...
-
No products found
because this supplier's products are not listed.
Agnès Roure, Rafath Chowdhury, Sébastien Darras,
bioRxiv - Developmental Biology 2022
Quote:
... or 2.5 μM of the BMP receptor inhibitor DMH1 (S7146, Euromedex, 10 mM stock solution in DMSO) at the stages indicated in the text and figures ...
-
No products found
because this supplier's products are not listed.
Sylvie Roy, et al.,
bioRxiv - Microbiology 2020
Quote:
... Serial dilutions of known amounts of C-terminally Fc-tagged S2 (BioVendor, Brno, Czech Republic) were used for quantification.
-
No products found
because this supplier's products are not listed.
Electra Brunialti, et al.,
bioRxiv - Neuroscience 2021
Quote:
... supplemented with 10% FBS (Fetal Bovine Serum Ultra-Low Endotoxin, ECS0186L, Euroclone), 1% streptomycin–penicillin (Cat ...
-
No products found
because this supplier's products are not listed.
Claudia Prahst, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... 3% BSA (Nzytech), 0.5% Triton X100 (Sigma) ...
-
No products found
because this supplier's products are not listed.
Donggi Paik, et al.,
bioRxiv - Immunology 2021
Quote:
... 3-oxoLCA (Steraloids (C1750-000 ...
-
LC Laboratories' Product Number G-5903 - GW2580, Free Base (cFMS Receptor Tyrosine Kinase...
Cat# G-5903, SKU# G-5903_10g,
10 g, $2670.00
Ask
Sehar Ali, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... VEGFR2 tyrosine kinase inhibitor (Vatalanib) and colony stimulating factor 1 receptor (CSF1R) inhibitor (GW2580) were purchased from LC Laboratories, Woburn ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
No products found
because this supplier's products are not listed.
Huan Ma, et al.,
bioRxiv - Immunology 2022
Quote:
... The recombinant vectors were transiently transfected into HEK293F cells with polyethyleneimine (Polyscience). After three days of expression ...
-
No products found
because this supplier's products are not listed.
Ranjie Xu, et al.,
bioRxiv - Neuroscience 2021
Quote:
... CHIR99021 (3 mM, Biogems), human leukemia inhibitory factor (hLIF ...
-
No products found
because this supplier's products are not listed.
Petra Vizjak, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Cyanin-3-maleimide (Lumiprobe) was dissolved in DMSO to final concentration 100 mM and added to solution in 5.7 fold excess ...
-
No products found
because this supplier's products are not listed.
Sachiko Koyama, et al.,
bioRxiv - Physiology 2019
Quote:
... culture medium was replaced with low calcium medium (CnT-PR, CELLnTECH; Zen-Bio, Research Triangle Park, NC) and penicillin streptomycin (1140122 ...
-
No products found
because this supplier's products are not listed.
Koki Yoshimoto, et al.,
bioRxiv - Bioengineering 2023
Quote:
... 3 µM CHIR99021(ReproCELL, Kanagawa, Japan), and 1% (v/v ...
-
No products found
because this supplier's products are not listed.
Lars Gruber, et al.,
bioRxiv - Biochemistry 2023
Quote:
Monoculture and biculture spheroids of CCD-1137Sk human fibroblasts and HT-29 human colon cancer cells (both LGC Standards, Wesel, Germany) were prepared ...
-
No products found
because this supplier's products are not listed.
Vijay K Samineni, et al.,
bioRxiv - Neuroscience 2021
Quote:
Anxiety was measured in low light conditions (~20 lux) using a modified zero maze (Stoelting Co., Wood Dale, IL) placed 70 cm off of the ground and consisting of two closed sections (wall height ...
-
No products found
because this supplier's products are not listed.
Chao Gao, et al.,
bioRxiv - Biochemistry 2020
Quote:
... for 3 min and separated on a C18 analytical column (picofrit 75 μm ID x 150 mm, 3 μm, New Objective) using a linear gradient of 2 % to 45 % solvent B (80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...
-
No products found
because this supplier's products are not listed.
Astrid Kollewe, et al.,
bioRxiv - Biochemistry 2021
Quote:
... manually packed 11 cm (AP-MS) or 23 cm (csBN-MS) with ReproSil-Pur 120 ODS-3 (C18; particle size 3 µm; Dr. Maisch HPLC, Germany) and electrosprayed (2.3 kV ...
-
No products found
because this supplier's products are not listed.
Claire Rabut, et al.,
bioRxiv - Neuroscience 2023
Quote:
... A craniectomy was performed to remove 0.5mm × 1 cm of the skull by drilling (Foredom) at low speed using a micro drill steel burr (Burr number 19007-07, Fine Science Tools). We took care to avoid damage to the dura and prevent brain inflammation ...
-
No products found
because this supplier's products are not listed.
Jacob W. Myerson, et al.,
bioRxiv - Bioengineering 2020
Quote:
... with separate compartments for each mouse (MPC-3 AERO; Braintree Scientific). To maintain adequate hydration ...