-
No products found
because this supplier's products are not listed.
Joseph de Rutte, et al.,
bioRxiv - Bioengineering 2021
Quote:
... antibody atezolizumab and the anti-interleukin 8 receptor beta (IL-8Rb) antibody 10H2 were cloned into the gwiz mammalian expression vector (Genlantis) and used for transient transfection of HEK 293T cells loaded into nanovials ...
-
No products found
because this supplier's products are not listed.
Shiri Levy, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... 25 ng/ml human recombinant FGF4 (Reliatech), 2 ng/ml human recombinant TGF-ß1 (PeproTech) ...
-
No products found
because this supplier's products are not listed.
Nanditha Anandakrishnan, et al.,
bioRxiv - Bioengineering 2020
Quote:
... RFP-tagged human umbilical vein endothelial cells (RFP-HUVECs, Angio-proteomie) were cultured in endothelial cell growth medium (EGM-2 ...
-
No products found
because this supplier's products are not listed.
MEENAKSHI TETORYA, et al.,
bioRxiv - Plant Biology 2023
Quote:
... The His-tagged peptides (GMA4CG_WT and GMA4CG_V6) phospholipid binding assays were performed using the PIP StripsTM (Echelon Biosciences Inc., CA) as previously described (Islam et al. ...
-
Recombinant Interleukin 2 Receptor Alpha (IL2Ra) is a recombinant Human protein produced in E....
Cat# abx067497-5MG,
5 mg USD $6438.0
Ask
Isabel Brandão, et al.,
bioRxiv - Physiology 2023
Quote:
... or after the primary antibody was incubated with recombinant Human Peroxidasin Homolog Protein (Abbexa; catalog # abx068474), in equimolar (1:1 ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
LDH-A inhibitor
Sold for research purposes only.
Cat# 2450.0, SKU# 2450-5 mg,
5mg, US $99.00 / EA, EURO, €90 / EA
Ask
Daniel J. Steinberg, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 2.5µg/ml human recombinant Insulin (Biological Industries; 41-975-100) and 3µM CHIR-99021 (Axon Medchem ; 1386) sterilized through 0.22μm filter ...
-
No products found
because this supplier's products are not listed.
Nadine R King, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 2 mg/ml Human Serum Albumin (HSA; Irvine Scientific), 10 μg/ml insulin (Sigma) ...
-
No products found
because this supplier's products are not listed.
Kerrie L. Marie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Lot# CA36131)/ 1:400 KDEL Receptor 3 (L95) polyclonal (Bioworld Technology Cat# BS3124 ...
-
No products found
because this supplier's products are not listed.
Tyler B. Waltz, et al.,
bioRxiv - Neuroscience 2023
Quote:
Recombinant rat protein p11 (S100A10 Recombinant Protein, Aviva Systems Biology, OPCD06771) was dissolved in distilled water to obtain a final concentration of 100ug/mL and stored at -80C for less than one month ...
-
No products found
because this supplier's products are not listed.
Yunye Zhu, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... Transformants scraped from densely plated transformation plates were inoculated into fresh SC-His medium with 2% raffinose (Amresco, J392) at 0.25 x 107 cells/ml and grown until 0.5-0.8 x 107 cells/ml ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... His-tag antibody (Tiangen, Beijing, China) and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Lisa Koshko, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or alpha MSH (rabbit, Phoenix Pharmaceuticals INC, 1:1000) primary antibody ...
-
No products found
because this supplier's products are not listed.
Khairunnisa Mentari Semesta, et al.,
bioRxiv - Cell Biology 2020
Quote:
sgRNA transduced cells seeded on 6-well plates at ~60% confluency were transfected with 2 μg flag-tagged β2-AR for 48 hr using JetPrime Transfection reagent (Genesee, Cat #55134) following manufacturer’s protocols ...
-
No products found
because this supplier's products are not listed.
Erin A. Akins, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Microglia were polarized to M2 with 50 ng/ml interleukin-4 (IL-4, Bio Basic, RC212-15-5) for 48 hours.
-
No products found
because this supplier's products are not listed.
Rasmus Riemer Jakobsen, et al.,
bioRxiv - Microbiology 2021
Quote:
The human colon adenocarcinoma cell line Caco-2 (ATTC HTB-37, LGC standards, Middlesex, UK) at passage 53 was grown in Dulbecco’s Modified Eagles Medium (DMEM ...
-
No products found
because this supplier's products are not listed.
Luisa Santus, et al.,
bioRxiv - Genomics 2022
Quote:
... we removed duplicates from the samples tagged with UMIs (Zyagen) (Supplemental Table S1 ...
-
No products found
because this supplier's products are not listed.
Anil H. Kadam, et al.,
bioRxiv - Bioengineering 2022
Quote:
... recombinant hu TGF-β1(ProSci, Poway, CA), anti-TGF-β1 IgY-Biotin (R&D Systems ...
-
No products found
because this supplier's products are not listed.
Yadira M. Soto-Feliciano, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... Human wild-type or mutant (K4M) histone H3.1 were cloned into pCDH-EF1-MCS-IRES-RFP (System Biosciences, CD531A-2). To express sgRNAs ...
-
No products found
because this supplier's products are not listed.
Kenji Shimada, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... then 0.002 U of recombinant hOGG1 (Trevigen, 4130-100-E) was added to one sample and further incubated for 30 min at 37°C ...
-
No products found
because this supplier's products are not listed.
Agnès Roure, Rafath Chowdhury, Sébastien Darras,
bioRxiv - Developmental Biology 2022
Quote:
... or 2.5 μM of the BMP receptor inhibitor DMH1 (S7146, Euromedex, 10 mM stock solution in DMSO) at the stages indicated in the text and figures ...
-
No products found
because this supplier's products are not listed.
Iromi Wanigasuriya, et al.,
bioRxiv - Genomics 2022
Quote:
... The 3’ end of each oligonucleotide probe was fluorescently tagged using Quasar dyes (Biosearch technologies). Bl6-specific oligos were labelled with Quasar 570 and Cast-specific oligos labelled with Quasar 670 ...
-
No products found
because this supplier's products are not listed.
Michelle Y. Fry, et al.,
bioRxiv - Biophysics 2023
Quote:
... an Alpha Plan-Apochromat 100x/1.46 NA Oil TIRF Objective M27 and Prime 95B scientific CMOS camera (Photometrics). MitoTrackerTM-stained mitochondria were imaged using “Cy5” filter set (Cy5-4040C ...
-
No products found
because this supplier's products are not listed.
Firyal Ramzan, et al.,
bioRxiv - Cell Biology 2023
Quote:
... alkyne-tagged fatty acid analogs (alkyne-myristate (13-tetradecylnoic acid; 13-TDYA; Click Chemistry Tools 1164) or alkyne-palmitate (15-hexadecynoic acid ...
-
No products found
because this supplier's products are not listed.
Huan Ma, et al.,
bioRxiv - Immunology 2022
Quote:
... The recombinant vectors were transiently transfected into HEK293F cells with polyethyleneimine (Polyscience). After three days of expression ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Assaf Alon, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Purified σ2 receptor was reconstituted into lipidic cubic phase (LCP) by mixing with a 10:1 (w:w) mix of monoolein (Hampton Research) with cholesterol (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
HR Holmes, et al.,
bioRxiv - Bioengineering 2024
Quote:
... we diluted samples of gamma-irradiated SARS-CoV-2 virus isolate USA-WA1/2020 (BEI #NR-52287) in human nasal wash (Lee Biosolutions #991-26-P) which were used as reference samples ...
-
No products found
because this supplier's products are not listed.
Adelaide Tovar, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... All animals were housed in groups of 1-5 on ALPHA-Dri bedding (Shepard) with ad libitum food (Envigo 2929) and water ...
-
No products found
because this supplier's products are not listed.
Daniel Schindler, et al.,
bioRxiv - Synthetic Biology 2022
Quote:
... The DNA Hi-C libraries were sheared into 300 bp using a Covaris S220 apparatus (Covaris) and the biotin-labeled fragments were selectively captured by Dynabeads Myone Streptavidin C1 ...
-
No products found
because this supplier's products are not listed.
Damian Dudka, R. Brian Akins, Michael A. Lampson,
bioRxiv - Cell Biology 2023
Quote:
... Centromeres were labeled with CREST (human anti-human Anti-Centromere Antibody, 1:200, Immunovision, HCT-0100) and an Alexa Fluor 594–conjugated goat anti-human secondary antibody (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Anna K. Hundsdoerfer, et al.,
bioRxiv - Genomics 2023
Quote:
... euphorbiae (from one head each; the same individuals used for the PacBio genome and Hi-C sequencing) and neural tissue from the internal reference standard Acheta domesticus (female ...
-
No products found
because this supplier's products are not listed.
Aum R. Patel, et al.,
bioRxiv - Microbiology 2021
Quote:
Normal Adult Human Dermal Fibroblasts and Normal Human Skeletal Muscle Satellite Cells (SkMc) (Lifeline Cell Technologies, USA) were cultured using FibroLife S2 Medium and StemLife SK Medium ...
-
2 Well Chambered Cover Glass with #1.5 high performance cover glass (0.170±0.005mm), with lid,...
Cat# C2-1.5H-N,
48/case, $219.00
Ask
Amy R. Strom, et al.,
bioRxiv - Biophysics 2020
Quote:
... was added to HP1α-AID-sfGFP cells expressing an miRFP-tagged histone H2B plated in 96-well glass bottom plates (Cellvis). 25 X-Y points were chosen in each of the control and experimental wells ...
-
No products found
because this supplier's products are not listed.
Aruna Pal, Abantika Pal, Pradyumna Baviskar,
bioRxiv - Genomics 2020
Quote:
... Gene fragment insert in the recombinant plasmid was sequenced by an automated sequencer (ABI prism) using the dideoxy chain termination method with T7 and SP6 primers (Chromous Biotech ...
-
No products found
because this supplier's products are not listed.
Katerina Jerabkova, et al.,
bioRxiv - Cell Biology 2020
Quote:
... human polyclonal CREST (Antibodies Incorporated, 15 234), rabbit polyclonal Aurora B (Abcam ab2254) ...
-
No products found
because this supplier's products are not listed.
Joelle P. Straehla, et al.,
bioRxiv - Bioengineering 2021
Quote:
Human iPS-ECs (Fujifilm Cellular Dynamics, 11713), human brain PCs and ACs (ScienCell) ...
-
No products found
because this supplier's products are not listed.
Jianfang Li, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Human C-peptide levels in isolated plasma were quantified using the STELLUX Chemi Human C-peptide ELISA kit (ALPCO Diagnostics) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Vanessa Nunes, et al.,
bioRxiv - Cell Biology 2019
Quote:
... 5]-PEG(2) (SuSoS) in 10 mM HEPES at pH 7.4 ...
-
No products found
because this supplier's products are not listed.
J.A. Fernandez-Leon, et al.,
bioRxiv - Neuroscience 2021
Quote:
... An optogenetic interface (Ami-2, Stoelting) and an electrical stimulator (Master 9 ...
-
No products found
because this supplier's products are not listed.
María del Carmen Muñoz-Marín, et al.,
bioRxiv - Microbiology 2021
Quote:
... The tubes were agitated for 2 min with a Vortex-Genie 2 bead beater (Scientific Industries, Inc), and incubated for 1 h at 55°C with 20 mg ml−1 proteinase K (Qiagen) ...
-
No products found
because this supplier's products are not listed.
Linyi Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Human trapezial cartilage was ground to a powder using Cryo-Cup Grinder (Biospec, Bartlesville) and then RNA was extracted using Qiagen RNeasy Micro Kit.
-
No products found
because this supplier's products are not listed.
John Stegmayr, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... A 7000SMZ-2 Vibrotome (Campden Instruments Ltd.) equipped with a temperature controlled tissue bath (Campden Instruments Ltd. ...
-
No products found
because this supplier's products are not listed.
Maxwell C. McCabe, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and a 2-mm thumb punch (Kent Scientific) was used to generate punches across the medial ear pinna in the right and left ears ...
-
No products found
because this supplier's products are not listed.
Jérôme Montnach, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... Low resistance borosilicate glass pipettes (2-3 MΩ; Sutter Instruments) were filled with a solution containing (in mM) ...
-
No products found
because this supplier's products are not listed.
Shaun M. Christie, et al.,
bioRxiv - Biophysics 2021
Quote:
... Recombinant human Semaphorin 3A (CX65, Bon Opus Biosciences, Milburn, NJ) contains residues 21-771 and is >95% pure ...
-
No products found
because this supplier's products are not listed.
Vincent Soubannier, et al.,
bioRxiv - Neuroscience 2019
Quote:
... human iPSC-derived astrocytes were incubated with tumour necrosis factor alpha (TNFa) (30 ng/ml; Cell Sciences; Newburyport, MA; Cat. No. CRT100B), interleukin alpha (IL-1a ...
-
No products found
because this supplier's products are not listed.
Agnes Ulfig, et al.,
bioRxiv - Biochemistry 2019
Quote:
α2-Macroglobulin was purified from human plasma (obtained from Zen-Bio, Inc. ...
-
No products found
because this supplier's products are not listed.
Kui K. Chan, et al.,
bioRxiv - Biochemistry 2020
Quote:
... and anti-HIS-FITC (chicken polyclonal, 1/100 dilution; Immunology Consultants Laboratory) secondary antibodies for 20 minutes at 4°C ...
-
No products found
because this supplier's products are not listed.
Jack A. Bryant, et al.,
bioRxiv - Microbiology 2020
Quote:
Purified recombinant BepA was used with proprietary crystal screens (supplied by Molecular Dimensions and Jena Bioscience) in sitting drop crystallization experiments using 2 μl of protein solution and 2 μl of crystallization mother liquor at 18°C ...