-
No products found
because this supplier's products are not listed.
Belinda Liu, et al.,
bioRxiv - Biochemistry 2019
Quote:
... or the insulin receptor signal peptide were synthesized by Eton Biosciences. Similarly ...
-
No products found
because this supplier's products are not listed.
Cathal Meehan, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
No products found
because this supplier's products are not listed.
Jiao Wang, et al.,
bioRxiv - Immunology 2020
Quote:
... Recombinant human interleukin-12 (IL-2) was gifted from Akron Biotech. Recombinant human interleukin-15 (IL-15 ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Lauren Podmore, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... 10ug/ml Insulin (Biogems #10-365), 1% Penicillin/Streptomycin (Wisent Inc #450-201-EL ...
-
No products found
because this supplier's products are not listed.
Jan-Renier A.J. Moonen, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Flag-tagged KLF4 (#VH829440, Vigene Biosciences) or GFP control (AVP004, GenTarget Inc) for 12 h after which cells were allowed to recover for 90 h before being harvested for subsequent experiments.
-
No products found
because this supplier's products are not listed.
Kari H. Ecklund, et al.,
bioRxiv - Cell Biology 2021
Quote:
Anti-His-coated 0.44 μm microbeads (PSS4; Spherotech; prepared as described previously72) were incubated with purified 6His-GFP-3HA-GST-dynein331-HALO in dynein trapping buffer (30 mM HEPES pH 7.2 ...
-
No products found
because this supplier's products are not listed.
Michael S. Balzer, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... and 10 U/ml recombinant mouse interferon-□ (Cell Sciences, Canton, MA) at 33 °C (permissive conditions ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
No products found
because this supplier's products are not listed.
Balaji Karthick Subramanian, et al.,
bioRxiv - Pathology 2019
Quote:
... Human primary podocytes from Celprogen Inc ...
-
No products found
Amy R. Strom, et al.,
bioRxiv - Biophysics 2020
Quote:
... was added to HP1α-AID-sfGFP cells expressing an miRFP-tagged histone H2B plated in 96-well glass bottom plates (Cellvis). 25 X-Y points were chosen in each of the control and experimental wells ...
-
No products found
because this supplier's products are not listed.
Nadine R King, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 2 mg/ml Human Serum Albumin (HSA; Irvine Scientific), 10 μg/ml insulin (Sigma) ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...
-
No products found
because this supplier's products are not listed.
Elena Arutyunova, et al.,
bioRxiv - Biophysics 2021
Quote:
... The fusion protein was subsequently digested with His-tagged SUMO protease (McLab, South San Francisco, CA) at 4 °C for 1–2 h to remove the SUMO tag and the resulting cleavage mixture was then passed through Ni-NTA resin column ...
-
No products found
because this supplier's products are not listed.
Menglin Shi, Lei Zhao, Yong Wang,
bioRxiv - Plant Biology 2021
Quote:
The recombinant HPRs was purified with HIS-Select nickel affinity gel filler (CoWin Biosciences, Beijing, China). Briefly ...
-
No products found
because this supplier's products are not listed.
Peter Hanna, et al.,
bioRxiv - Neuroscience 2020
Quote:
... A quadripolar His catheter (Abbott) was placed via the right external jugular vein and advanced until a His signal was visualized while a quadripolar catheter was inserted via the right femoral vein and advanced to the right atrium ...
-
No products found
because this supplier's products are not listed.
Nanami Sakata, et al.,
bioRxiv - Plant Biology 2022
Quote:
... L-His (Tokyo Chemical Industry), and L-Lys (Nacalai tesque ...
-
No products found
because this supplier's products are not listed.
Joakim Lehrstrand, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Primary antibodies used consisted of guinea pig anti-insulin/pro-insulin (INS; Cat. No. 16049; Progen Biotechnik, Germany; diluted 1:3000) and rabbit anti-glucagon/pro-glucagon (GCG ...
-
No products found
because this supplier's products are not listed.
Bryan J. González, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and 2 µM R428 (Tyrosine kinase receptor AXL inhibitor) (ApexBio, A8329). From d1 to d11 media was changed every day and from d12 to d27 media was changed every other day ...
-
No products found
because this supplier's products are not listed.
Liangbo Qi, et al.,
bioRxiv - Biophysics 2019
Quote:
... 3.5 μl aliquots of the recombinant human TIM22 complex (7 mg ml-1) were dropped onto glow discharged holey carbon grids (Quantifoil Au R1.2/1.3, 300 mesh), blotted with a Vitrobot Mark IV (ThemoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Bhaskar Saha, et al.,
bioRxiv - Cell Biology 2023
Quote:
... All GST-tagged proteins were expressed in Escherichia coli SoluBL21 (Genlantis). GST fusion proteins were purified on glutathione-Sepharose 4 Fast Flow beads (GE Healthcare 17-5132-01) ...
-
No products found
because this supplier's products are not listed.
Julia A Alvarez, et al.,
bioRxiv - Microbiology 2024
Quote:
... 20% heat inactivated (HI) fetal bovine serum (FBS) (Omega Scientific), 1% penicillin-streptomycin (Life Technologies ...
-
No products found
because this supplier's products are not listed.
Hiroshi Ichise, et al.,
bioRxiv - Immunology 2021
Quote:
... Recombinant mouse thrombin was obtained from antibodies-online GmbH (Aachen ...
-
No products found
because this supplier's products are not listed.
William S. Lawrence, et al.,
bioRxiv - Microbiology 2023
Quote:
... Biotinylated recombinant PA83 (List Biological Labs, Campbell, CA) was bound to streptavidin-coated plates (MesoScale Discovery ...
-
No products found
because this supplier's products are not listed.
Xiaoning Yang, et al.,
bioRxiv - Immunology 2023
Quote:
... C1q recombinant protein (A400) was purchased from Quidel and its secondary anti C1q/HRP (ab46191 ...
-
No products found
because this supplier's products are not listed.
MO. Akiibinu, et al.,
bioRxiv - Physiology 2020
Quote:
Plasma level of insulin was determined by using a commercially prepared kit (CUSABIO Rat insulin ELISA kit ...
-
No products found
because this supplier's products are not listed.
Matheus F. Sathler, et al.,
bioRxiv - Neuroscience 2022
Quote:
... NIH: HIV-1 IIIB gp120 Recombinant Protein from ImmunoDX, LLC ...
-
No products found
because this supplier's products are not listed.
Einat Bigelman, et al.,
bioRxiv - Cell Biology 2022
Quote:
... which recognizes the native form of the extracellular portion of the receptor (Biorbyt, England, clone orb399781) followed by flow cytometry analysis.
-
No products found
because this supplier's products are not listed.
Rory Henderson, et al.,
bioRxiv - Immunology 2023
Quote:
... The synthetic Toll-like receptor 7/8 agonist 3M-052 absorbed to ALUM (3M-052-ALUM) was used as the adjuvant for the vaccine immunogens ...
-
No products found
because this supplier's products are not listed.
Ben S. Ou, et al.,
bioRxiv - Bioengineering 2023
Quote:
... HIS Lite Cy3 Bis NTA-Ni Complex was purchased from AAT Bioquest. Unless otherwise stated ...
-
No products found
because this supplier's products are not listed.
Advika Kamatar, et al.,
bioRxiv - Biophysics 2023
Quote:
... His-Clathrin was labeled with Atto594 NHS-ester (ATTO-TEC, Sigma-Aldrich) according to a previously published protocol (41 ...
-
No products found
because this supplier's products are not listed.
Kenji Shimada, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... then 0.002 U of recombinant hOGG1 (Trevigen, 4130-100-E) was added to one sample and further incubated for 30 min at 37°C ...
-
No products found
because this supplier's products are not listed.
Arun Upadhyay, et al.,
bioRxiv - Neuroscience 2023
Quote:
... 10 nM recombinant MT3 protein (Boster Bio Cat no. PROTP25713) was added at a in additional wells ...
-
No products found
because this supplier's products are not listed.
Álvaro Inglés-Prieto, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Transgenic flies expressing Opto-dRET and Opto-dRETMEN2B were generated by injection of pUAST receptor constructs (BestGene). For selection ...
-
No products found
because this supplier's products are not listed.
Iromi Wanigasuriya, et al.,
bioRxiv - Genomics 2022
Quote:
... The 3’ end of each oligonucleotide probe was fluorescently tagged using Quasar dyes (Biosearch technologies). Bl6-specific oligos were labelled with Quasar 570 and Cast-specific oligos labelled with Quasar 670 ...
-
No products found
because this supplier's products are not listed.
Marisa Oliveira, et al.,
bioRxiv - Immunology 2020
Quote:
... and chicken interferon alpha (Yeast-derived Recombinant Protein, Kingfisher Biotech, Inc) were diluted in nuclease-free water (Ambion ...
-
No products found
because this supplier's products are not listed.
Ida Søgaard Larsen, et al.,
bioRxiv - Microbiology 2023
Quote:
... Blood samples for quantification of plasma insulin levels were sampled in EDTA prepared capillary tubes (Sarstedt) at time points 0 ...
-
No products found
because this supplier's products are not listed.
Wiktoria Ogrodzińska, et al.,
bioRxiv - Biochemistry 2024
Quote:
... The recombinant plasmids were isolated using plasmid purification kit (Bio Basic Canada) and the inserts were verified by sequencing (Genomed ...
-
No products found
because this supplier's products are not listed.
Nicolas Lamassiaude, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... Recombinant constructs were purified using EZNA Plasmid DNA Mini kit (Omega Bio-Tek) and sequence-checked (Eurofins Genomics) ...
-
No products found
because this supplier's products are not listed.
Daniel Schindler, et al.,
bioRxiv - Synthetic Biology 2022
Quote:
... The DNA Hi-C libraries were sheared into 300 bp using a Covaris S220 apparatus (Covaris) and the biotin-labeled fragments were selectively captured by Dynabeads Myone Streptavidin C1 ...
-
CDH18 is expressed specifically in the central nervous system and is putatively involved in...
Cat# 5090-0.1MG,
0.1 mg, USD $235.0
Ask
Haiqing Bai, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Human collagen-I (Advanced Biomatrix, #5007) was prepared according to manufacturer’s instruction ...
-
No products found
because this supplier's products are not listed.
Antonin Tutter, et al.,
bioRxiv - Biochemistry 2024
Quote:
... the indicated concentrations of purified 6His-tagged BRD4 were spotted onto blank nitrocellulose-coated glass slides (Grace Bio-Labs PATH protein microarray slides ...
-
No products found
because this supplier's products are not listed.
Aruna Pal, Abantika Pal, Pradyumna Baviskar,
bioRxiv - Genomics 2020
Quote:
... Gene fragment insert in the recombinant plasmid was sequenced by an automated sequencer (ABI prism) using the dideoxy chain termination method with T7 and SP6 primers (Chromous Biotech ...
-
No products found
because this supplier's products are not listed.
Charles A. Specht, et al.,
bioRxiv - Immunology 2021
Quote:
... the recombinant proteins were resolved on SDS-PAGE and stained with Coomassie InstantBlue (Expedeon, Ltd.).
-
No products found
because this supplier's products are not listed.
Tobias Tertel, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 12 nM anti-human CD63 PE (EXBIO) or 13 nM anti-human CD81 PE (Beckman Coulter) ...
-
No products found
because this supplier's products are not listed.
Nazila V. Jafari, Jennifer L. Rohn,
bioRxiv - Microbiology 2022
Quote:
HBLAK human bladder progenitor cells (CELLnTEC, Switzerland) were grown according to the CELLnTEC protocol ...
-
No products found
because this supplier's products are not listed.
Yuichi Mitsui, et al.,
bioRxiv - Immunology 2022
Quote:
Human PBMCs were purchased from Precision for Medicine, Inc ...
-
No products found
because this supplier's products are not listed.
Piyakarn Boontem, Tetsumori Yamashima,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... rabbit anti-human activated μ-calpain antibody (PEPTIDE Institute, Japan) at 1:250 overnight ...
-
No products found
because this supplier's products are not listed.
Mutsumi Kobayashi, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Human iPSCs were dissociated using Accutase (Innovative Cell Technologies, AT104) and suspended in mTeSR plus (Stemcell Technologies ...
-
No products found
because this supplier's products are not listed.
JM Robinson, et al.,
bioRxiv - Immunology 2019
Quote:
... I-FABP (Human I-FABP ELISA Kit, Hycult biotech, Cat# HK406), and LBP (Human Lipopolysaccharide Binding Protein ELISA Kit ...