-
No products found
because this supplier's products are not listed.
Jin-Ran Chen, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Serum bone resorption marker C-terminal telopeptides of type I collagen (CTX-1) was measured by Rat-LapsTM ELISA from Nordic Biosciences Diagnostic (Herlev ...
-
No products found
because this supplier's products are not listed.
JM Robinson, et al.,
bioRxiv - Immunology 2019
Quote:
... and LBP (Human Lipopolysaccharide Binding Protein ELISA Kit, Cell Sciences, Inc., Cat# CKH113).
-
No products found
because this supplier's products are not listed.
Razieh Rafieenia, et al.,
bioRxiv - Microbiology 2022
Quote:
... Glyphosate concentrations were measured using a glyphosate ELISA kit (Abraxis, Eurofin Technologies, Hungary).
-
No products found
because this supplier's products are not listed.
Bryana N. Harris, et al.,
bioRxiv - Systems Biology 2022
Quote:
Cardiac myocytes were isolated from 1-2-day-old Sprague-Dawley rats using a Neomyt isolation kit (Cellutron, USA). The cells were cultured in plating media (low-glucose Dulbecco’s modified eagle media (DMEM) ...
-
No products found
because this supplier's products are not listed.
Ariane C. Scheuren, et al.,
bioRxiv - Physiology 2020
Quote:
... Markers for bone formation and resorption were measured in technical duplicates using ELISA kits for N-terminal propeptide of type I procollagen (PINP, AC-33F, Immunodiagnostics) and for C-terminal cross-linked telopeptides of type I collagen (CTX-I ...
-
No products found
because this supplier's products are not listed.
Dali Zong, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... 5 min at 37°C), washed, dehydrated with ethanol, briefly heat denatured (80°C, 1 min 15 s) in a slide moat (Boekel Scientific) and incubated with a commercially available Cy3-labeled (CCCTAA)3 peptide nucleic acid probe (PNA Bio ...
-
No products found
because this supplier's products are not listed.
Thanh Ngoc Nguyen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... equipped with a 45 °C diamond knife (Diatome) was used to section the resin embedded samples ...
-
No products found
because this supplier's products are not listed.
Owen J. Chen, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... MEFs were maintained at 37°C in DMEM (Wisent Bioproducts: 4.5 g/L glucose ...
-
No products found
because this supplier's products are not listed.
Jessica J. Rea, et al.,
bioRxiv - Neuroscience 2024
Quote:
... short hairpin RNAs targeting rat OXTR mRNA was cloned and packaged into an adeno-associated virus (AAV1; Vector Biolabs) under the control of a U6 promoter and co-expressing green fluorescent protein (GFP ...
-
No products found
because this supplier's products are not listed.
Liangliang Hao, et al.,
bioRxiv - Bioengineering 2020
Quote:
... C-met nanobodies were coupled with Sulfo-Cyanine7 NHS ester (Lumiprobe), reacted overnight ...
-
No products found
because this supplier's products are not listed.
Sami T. Tuomivaara, et al.,
bioRxiv - Biochemistry 2023
Quote:
... supplemented with 2% in-house heat-treated (56 °C for 30 min) FBS (Atlanta Biologicals) and GlutaMAX (for proteomics) ...
-
No products found
because this supplier's products are not listed.
Fadil M. Hannan, et al.,
bioRxiv - Genetics 2020
Quote:
... and FGF23 using a two-site ELISA kit (Kainos Laboratories), as described (19) ...
-
No products found
because this supplier's products are not listed.
Hannah Donnelly, et al.,
bioRxiv - Bioengineering 2024
Quote:
... Enzyme-linked immunosorbent assays (ELISA) was then carried out as per manufacturer’s instructions (R&D Systems, BMP-2 DuoSet ELISA kit, DY355). Briefly ...
-
No products found
because this supplier's products are not listed.
Hemangi Patil, Kyoung-in Cho, Paulo A. Ferreira,
bioRxiv - Genetics 2024
Quote:
The UbiQuant ELISA kit as directed by the manufacturer (LifeSensors, Malvern, PA) was used to determine the absolute and total amount of ubiquitin and ubiquitylated proteins in the RPE ...
-
No products found
because this supplier's products are not listed.
Laura Virtanen, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... rat monoclonal HSF1 (1:400, 10H8, StressMarq Bioscience Inc.), rabbit monoclonal Lap2α (1:1000 ...
-
No products found
because this supplier's products are not listed.
Steven J. Grzegorski, et al.,
bioRxiv - Genetics 2019
Quote:
... Prothrombin levels in the expression media and the cell lysate were then quantified by ELISA using a matched-pair antibody set ELISA kit (Affinity Biologicals Inc.; FII-EIA).
-
No products found
because this supplier's products are not listed.
Tomasz Zieliński, et al.,
bioRxiv - Biophysics 2022
Quote:
... CytoGlow™ Cofilin (Phospho-Ser3) Colorimetric Cell-Based ELISA Kit was applied (Assay Biotechnology) to monitor target proteins concentration ...
-
No products found
because this supplier's products are not listed.
Carina C D Joe, et al.,
bioRxiv - Bioengineering 2021
Quote:
Residual host-cell protein (HCP) was quantified using the HEK293 HCP ELISA kit (Cygnus Technologies) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Karla A. Vasco, et al.,
bioRxiv - Microbiology 2023
Quote:
... biochemical identification of Gram-negative ceftiofur resistant strains was done with oxidase tests (OxiStripsTM, Hardy Diagnostics) and Chromocult® Coliform agar (Merck KGaA ...
-
No products found
because this supplier's products are not listed.
Paul Batty, et al.,
bioRxiv - Cell Biology 2023
Quote:
... NIPBL was detected using a rat monoclonal antibody (Absea, 010702F01, 1:500). Sororin was detected using a custom rabbit antibody (1:500) ...
-
No products found
because this supplier's products are not listed.
Sebastian Gehlen-Breitbach, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... O9-1 medium was incubated with mitomycin C (Adooq Bioscience) inactivated STO mouse fibroblasts (ATCC ...
-
No products found
because this supplier's products are not listed.
Zhiyi Liu, et al.,
bioRxiv - Immunology 2022
Quote:
... Sections were then stained with 1:500 polyclonal rabbit anti-mouse/rat CCSP (Seven Hills Bioreagents) and mouse anti-Acetylated Tubulin ...
-
No products found
because this supplier's products are not listed.
Lisa G.M. van Baarsen, et al.,
bioRxiv - Immunology 2021
Quote:
... and podoplanin (Monoclonal Rat IgG2a, Clone #NZ-1, Catalog Number: 11-009; Angio Bio, San Diego, CA). The following isotype antibodies were used ...
-
No products found
because this supplier's products are not listed.
Hsiu-Chuan Lin, et al.,
bioRxiv - Bioengineering 2023
Quote:
... co-cultured with rat cortical astrocytes (Genlantis) on PLO/LMN-coated 8-well or 96-well polymer coverslips (µ-Slide ibiTreat ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Garth Blackler, et al.,
bioRxiv - Physiology 2023
Quote:
... overnight at 4°C and decalcified in Decal Stat (StatLab, PC-1212-1) for 24 hours ...
-
No products found
because this supplier's products are not listed.
Irina Sbornova, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Whole eye blots were probed overnight at 4 °C with 1 of two PDE11A antibodies: the pan-PDE11A antibody PD11-112 (1:1000, rabbit, Fabgennix) or the PDE11A4-specific antibody PDE11A#1-8113A (1:10,000 ...
-
No products found
because this supplier's products are not listed.
Manon Laporte, et al.,
bioRxiv - Microbiology 2019
Quote:
... the plates were stained overnight at 4°C with anti-NP antibody diluted in 1% BSA (for IAV: Hytest #3IN5 at 1/2000 and for IBV: Hytest #RIF17 at 1/2000). After washing in PBS containing 0.01% Tween ...
-
No products found
because this supplier's products are not listed.
Mengqi Luo, et al.,
bioRxiv - Biochemistry 2022
Quote:
... overnight at 4 °C and then HRP-conjugated secondary antibody (1:2000, ZEN BIO, China) for 1 hour at room temperature ...
-
No products found
because this supplier's products are not listed.
Zahrah Al Rumaih, et al.,
bioRxiv - Immunology 2020
Quote:
... The plates were then incubated at 37°C for 1 hour before 1 mL of overlay (1% methylcellulose (viscosity 400 centipoise, Spectrum Chemical Manufacturing corporation, NJ, USA), 2.5% FCS ...
-
No products found
because this supplier's products are not listed.
Nadezda A. Fursova, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Antibody-bound nucleosomes were captured for 1 hr at 4°C using protein A agarose (Repligen) beads ...
-
No products found
because this supplier's products are not listed.
Tongcui Ma, et al.,
bioRxiv - Microbiology 2023
Quote:
... or conjugated in-house with X8 antibody-labeling kits (Standard BioTools) and stored at 4°C in Antibody Stabilizer (Boca Scientific) supplemented with 0.05% sodium azide ...
-
No products found
because this supplier's products are not listed.
Dakota R. Robarts, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... Extracted 8 point calibration curves were made using blank rat serum (Pel-Freez Biologicals) spiked with PFAS appropriate for dosed (100 – 2,500 ng/ml ...
-
No products found
because this supplier's products are not listed.
Taewon Choi, et al.,
bioRxiv - Bioengineering 2022
Quote:
... rats were stereotactically implanted with five cortical screw electrodes (Fine Science Tools, 19010-00 screws). The implantation coordinates were adopted from a stereotactic atlas [30,31] ...
-
No products found
because this supplier's products are not listed.
Siu-Shing Wong, et al.,
bioRxiv - Cell Biology 2024
Quote:
... embryos were injected with the nanobody-coated beads and mRNA mix and incubated for a further 1 hour at 22°C prior to imaging on the Andor DragonFly 505 (Oxford Instruments) spinning disk system described below.
-
No products found
because this supplier's products are not listed.
Haichen Wang, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 1.0 U in 0.40 mL normal saline for rats) via Hamilton syringe (Hamilton Company; Reno, NV) advanced into the cortex (depth = 3 mm in mouse ...
-
No products found
because this supplier's products are not listed.
Holly M Craven, et al.,
bioRxiv - Microbiology 2020
Quote:
... and then incubated for 72 hrs at 4°C in 1:400 anti- G-Quadruplex antibody BG4 (Ab00174-10.6, Absolute Antibody, Oxford UK) diluted in blocking buffer ...
-
No products found
because this supplier's products are not listed.
Uxia Gurriaran-Rodriguez, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... cell pellets were lysed at 4°C using high-pressure homogenization at 25 Kpsi (1 Kpsi = 69 _ 103 MPa) (Constant System Ltd, UK) in lysis buffer [50 mM Tris-HCl pH:7.5 ...
-
No products found
because this supplier's products are not listed.
Ambre Guillory, et al.,
bioRxiv - Plant Biology 2024
Quote:
... and homogenized in GUS extraction buffer before 1 µg of total protein extracts were used for enzymatic reactions at 37°C using 1 mM of the 4-MUG substrate (4-Methylumbelliferyl-β-D-glucuronide hydrate, Biosynth M-5700). GUS activity was measured using a FLUOstar Omega 96 microplate reader (BMG LABTECH ...
-
No products found
because this supplier's products are not listed.
Yvan M. Vachez, et al.,
bioRxiv - Neuroscience 2020
Quote:
Mice were individually placed in a 30cm x 20cm behavioral arena (Lab Products Rat One Cage 2100™) and given 60 min/day to consume a highly palatable liquid (Nesquik® ...
-
No products found
because this supplier's products are not listed.
Manjing Zhang, et al.,
bioRxiv - Microbiology 2022
Quote:
... and dried down completely under nitrogen stream at 30 L/min (top) 1 L/min (bottom) at 30°C (Biotage SPE Dry 96 Dual; 3579M). To dried samples ...
-
No products found
because this supplier's products are not listed.
Alexis Vivoli, et al.,
bioRxiv - Cell Biology 2021
Quote:
... islets were washed once with D-PBS + 2 mM EDTA solution (339xg, 3 min, 4°C) and digested by enzymatic disaggregation for 10 min at 37°C using Accutase (Innovative Cell Technologies Inc., San Diego, CA, USA). The reaction was stopped using islet culture medium and the islet cell suspension was washed once with PBS and dead cells labeled using the LIVE/DEAD™ Fixable Aqua Dead Cell Stain Kit (405 nm ...
-
No products found
because this supplier's products are not listed.
Matthew Pierpoint, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Chromosomes were incubated in Tel C Cy 3 PNA probe (PNA Bio) at 83 °C for 5 minutes and allowed to hybridize at room temperature in a dark hybridization chamber for 2 hours at room temperature ...
-
No products found
because this supplier's products are not listed.
Mathieu Métivier, et al.,
bioRxiv - Cell Biology 2020
Quote:
... dialyzed overnight in PBS at 4°C and used for guinea pig immunization (Covalab).
-
No products found
because this supplier's products are not listed.
Martin Dlask, et al.,
bioRxiv - Biophysics 2019
Quote:
We used a measurement system based on cooled (−30 °C) low-noise photomultiplier tube (PMT) R2256-02 (all components of the system from Hamamatsu Photonics Deutschland ...
-
No products found
because this supplier's products are not listed.
Panga Jaipal. Reddy, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Analytical column (PICOCHIP: 105 cm, 1.9 µm, REPROSIL Pur C-18-AQ, 120 Å, New Objective, USA) with a flow rate of 300 nL/min was used for the separation of the peptides with a linear gradient of 5–35% buffer-B (90% acetonitrile in 0.1% FA ...
-
No products found
because this supplier's products are not listed.
Jimi L. Rosenkrantz, et al.,
bioRxiv - Developmental Biology 2021
Quote:
BeWo cells were cultured at 37°C 5% CO2 in Ham’s F-12 (Kaighn’s Modification) media (Caisson Labs, HFL06-500ML) supplemented with 10% FBS (Sigma ...
-
No products found
because this supplier's products are not listed.
Kerstin Menck, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... boiled for 5 min at 95°C and printed in triplicates onto nitrocellulose-coated glass slides (Oncyte Avid, Grace Bio-Labs). For blocking ...
-
No products found
because this supplier's products are not listed.
Hartwig Seitter, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 1 µM TTX (Biotrend, BN0518), pH = 7.4 with NaOH (S2770) ...
-
No products found
because this supplier's products are not listed.
Derin Sevenler, Mehmet Toner,
bioRxiv - Bioengineering 2023
Quote:
... The Ultra Rainbow Calibration bead kit (Spherotech URCP-38-2k) consists of 3.8 µm polystyrene particles which contain embedded six different fluorochromes that align to the most common flow cytometry excitation and emission filter sets ...