-
No products found
because this supplier's products are not listed.
Maria O. Levitin, et al.,
bioRxiv - Genetics 2022
Quote:
... and RPS6 (NSJ Bioreagents; 1:100, mouse anti-rabbit monoclonal). After incubation with primary antibodies ...
-
No products found
because this supplier's products are not listed.
Hanna Englert, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... the membranes were incubated with a goat anti-human FXII antibody (1:500, GAHu/FXII, Nordic-MUbio, The Netherlands) for 1h at RT ...
-
No products found
because this supplier's products are not listed.
Sophie E. Cousineau, et al.,
bioRxiv - Microbiology 2022
Quote:
... mouse anti-JFH-1 NS5A (clone 7B5, BioFront Technologies, 1:10,000). Blots were incubated for 1 hour with HRP-conjugated secondary antibodies diluted in 5% skim milk ...
-
No products found
because this supplier's products are not listed.
Haeyoung Kim, et al.,
bioRxiv - Cell Biology 2022
Quote:
... rat-anti RFP (1:500 dilution) (Bulldog Bio Inc, #RMA5F8) for over-night at 4°C ...
-
No products found
because this supplier's products are not listed.
Chanchal Thomas Mannully, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... 1 μg/mL of human TGFβ1 (Biogems, Peprotech).
-
No products found
because this supplier's products are not listed.
Suhas Sureshchandra, et al.,
bioRxiv - Immunology 2020
Quote:
... in RPMI supplemented with 1% Human AB Serum (Omega Scientific) for 7 days with media supplemented on day 3 ...
-
No products found
because this supplier's products are not listed.
Miho Matsuda, Chih-Wen Chu, Sergei Y. Sokol,
bioRxiv - Cell Biology 2021
Quote:
... mouse anti-DYKDDDDK mAb clone 2H8 (Cosmo Bio USA, #KAL- K0602, 1:1000) and mouse anti-GFP mAb clone B2 (Santa Cruz Biotechnology ...
-
No products found
because this supplier's products are not listed.
Amanda J. McLaughlin, et al.,
bioRxiv - Neuroscience 2020
Quote:
... sheep anti-secretagogin (BioVendor, RD1884120100 ...
-
No products found
because this supplier's products are not listed.
Yusha Sun, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... mouse anti-TPH2 (Thomas Scientific, AMAb91108), rabbit anti-TH (Novus Biologicals ...
-
No products found
because this supplier's products are not listed.
M. Julhasur Rahman, et al.,
bioRxiv - Microbiology 2021
Quote:
The mCherry-E3L integration sites in the purified HGT virus genomes were located by inverse PCR amplification and by PacBio sequencing ...
-
No products found
because this supplier's products are not listed.
Cecilia Martinez Campos, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Cells were split and infected with NL4-3 virus for 48h and then pulsed with 100µM of either 4SU (Carbosynth Cat #NT06186) or 6SG (Sigma Cat #858412 ...
-
No products found
because this supplier's products are not listed.
Veronica Jové, et al.,
bioRxiv - Cancer Biology 2023
Quote:
The open reading frame DNA sequences of human USP18(AA16-372) (Uniprot Q9UMW8) and human pro-ISG15(AA1-165)C78S (Uniprot P05161) were synthesized by GENEWIZ. C78S was substituted to stabilize ISG15 for purification (Narasimhan ...
-
No products found
because this supplier's products are not listed.
Marcus Buggert, et al.,
bioRxiv - Immunology 2020
Quote:
... bulk memory or virus-specific CD8+ T cells were sorted into cold fetal bovine serum and frozen in RNAzol (Molecular Research Center). TCRβ transcripts were amplified using a template-switch anchored RT-PCR ...
-
No products found
because this supplier's products are not listed.
Olivia C. Eller, et al.,
bioRxiv - Physiology 2020
Quote:
... which had the same caloric and macronutrient breakdown of the AID without the added anti-inflammatory components (Research Diets, Inc. New Brunswick, D17072403, NJ; Table 1).
-
No products found
because this supplier's products are not listed.
Nadine R King, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 2 mg/ml Human Serum Albumin (HSA; Irvine Scientific), 10 μg/ml insulin (Sigma) ...
-
No products found
because this supplier's products are not listed.
Magen E. Francis, et al.,
bioRxiv - Microbiology 2021
Quote:
... to confirm stability of the SARS-CoV-2 virus after culture in vDMEM (DMEM (Dulbecco’s Modified Eagle Medium) (Wisent Bioproducts (Cat # 319-005-CL)) ...
-
No products found
because this supplier's products are not listed.
Frederike Klimm, Thomas Speck, Marc Thielen,
bioRxiv - Plant Biology 2023
Quote:
... by using the primary antibody LM6 ([Anti-1,5-α-L-Arabinan] Antibody, Megazyme Ltd, Bray, Ireland) and a fluorescent marker (Alexa Fluor 568 goat anti-rat IgG (H+L) ...
-
No products found
because this supplier's products are not listed.
S. Karkampouna, et al.,
bioRxiv - Cell Biology 2021
Quote:
Mouse and human liver tissues were homogenised with UltraTurrax homogenizer (T25 basic, IKA) and TRIpure reagent (Roche) ...
-
No products found
because this supplier's products are not listed.
Xin Wang, et al.,
bioRxiv - Immunology 2022
Quote:
Mouse trachea and human ALI culture samples were harvested and fixed with 4% PFA (BM-155, Boston BioProducts) overnight at 4 °C ...
-
No products found
because this supplier's products are not listed.
Nahima Saliba, et al.,
bioRxiv - Biophysics 2023
Quote:
... Tubing (FEP 1/16” OD, 1/100” ID, Cole-Parmer) was connected from the pump to the microfluidic chip for solution perfusion.
-
No products found
because this supplier's products are not listed.
Bill Ling, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... and 44 µL of a 1:1 mixture of BTTAA (Click Chemistry Tools, 77.4 mg mL-1 PBS) and copper sulfate pentahydrate (7.4 mg mL-1 water) ...
-
LC Laboratories' Product Number I-5022 - Ixabepilone, Free Base (Azaepothilone B, BMS-247550,...
Cat# I-5022, SKU# I-5022_1mg,
1 mg, $129.00
Ask
Rohan N. Shah, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 1 µM PD0325901 (LC Laboratories), sterilized using 0.1 µm filter flask (Millipore) ...
-
No products found
because this supplier's products are not listed.
Elva Vidya, et al.,
bioRxiv - Molecular Biology 2024
Quote:
... anti CGH-1 (Rabbit #7199 production bleed 1:2000) (Capralogics). Commercial primary antibodies used were listed in Table S2 (Antibodies tab).
-
No products found
because this supplier's products are not listed.
Susanne Hellmuth, Olaf Stemmann,
bioRxiv - Cell Biology 2024
Quote:
... rabbit anti- histone H2A (1:1,000; 11-7017, Abeomics), rabbit anti-pS10-histone H3 (1:1,000 ...
-
No products found
because this supplier's products are not listed.
Yong Fu, et al.,
bioRxiv - Microbiology 2021
Quote:
... rabbit anti-tRFP (Axxora), mouse anti-6XHis (mAbHIS.H8 ...
-
No products found
because this supplier's products are not listed.
J Paes de Faria, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Alexa Fluor Anti-Rabbit 488 (Alfagene, A11008, 1.1000) and Cy 3-Conjugated AffiniPure Goat Anti-Mouse IgG (Jackson ImmunoResearch ...
-
No products found
because this supplier's products are not listed.
Hanyu Pan, et al.,
bioRxiv - Bioengineering 2022
Quote:
The proliferation of anti-HIV CAR-T cells was measured by using the Cell Counting Kit-8 (Dojindo Molecular technologies, Gaithersburg, MD, USA). Briefly ...
-
No products found
because this supplier's products are not listed.
Pabitra K. Parua, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... rabbit anti-Spt5-pSer666 and −pThr806 (21st Century Biochemicals) previously described 56 ...
-
No products found
because this supplier's products are not listed.
Jayanth S. Shankara Narayanan, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... or anti-Rabbit HRP Polymer (Cell IDX, 2RH-050) for 30 min ...
-
No products found
because this supplier's products are not listed.
Fabian Braun, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... 1:1000 and developed using poly-HRP-anti mouse/rabbit IgG (Bright Vision, Medac-diagnostica, Germany) and DAB away kit (Biocare Medical ...
-
No products found
because this supplier's products are not listed.
S. Iakhno, et al.,
bioRxiv - Microbiology 2021
Quote:
... USA) at 1:1200 and polyclonal rabbit anti F4 (catalogue number 51172, Statens serum institut, Copenhagen, Denmark) at 1:400 were used ...
-
No products found
because this supplier's products are not listed.
Anu G. Nair, Paola Muttathukunnel, Martin Müller,
bioRxiv - Neuroscience 2021
Quote:
... and Atto594 conjugated anti-mouse (ATTO-TEC; 1:100). Images were acquired using an upright Leica Stellaris or inverted Leica SP8 laser scanning microscope (University of Zurich Center for Microscopy and Image Analysis ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Mayank Verma, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... 1 µg/ml anti-FLT1 monoclonal antibody (Angio-Proteomie, MAB7072), inhibitors of FLK1 ...
-
No products found
because this supplier's products are not listed.
Jianying Liu, et al.,
bioRxiv - Microbiology 2020
Quote:
... Virus mixtures were subsequently mixed at a ratio of 1:1 with PBS-washed sheep blood cells (Hemostat laboratories, Galveston, TX, USA). Aliquots of blood meals were collected to verify the initial virus proportions in the inoculum ...
-
Recombinant Rabbit BCMA Protein, fused to His tag, was expressed in HEK293.
Cat# TNFRSF17-02R,
10ug , USD $198
Ask
Sunil Yeruva, et al.,
bioRxiv - Cell Biology 2023
Quote:
... were coated with 2 µg ml-1 recombinant human DSG2 (Creative Biomart; #DSG2-1601H) in 100 mM bicarbonate/carbonate coating buffer (3.03 g Na2CO3 ...
-
No products found
because this supplier's products are not listed.
Jonah C. Rosch, et al.,
bioRxiv - Bioengineering 2021
Quote:
... Fluorescently labeled human serum albumin (HS1-S5-1) was purchased from NANOCS (New York, NY). The starting DNA library ...
-
No products found
because this supplier's products are not listed.
Toshiyuki Ueki, et al.,
bioRxiv - Synthetic Biology 2019
Quote:
... and the HA Tag Polyclonal Antibody as primary antibodies and an anti-mouse IgG-gold (40 nm) antibody (40 nm Goat Anti-Mouse IgG gold conjugate, Expedeon) and the anti-rabbit IgG-gold (10 nm ...
-
No products found
because this supplier's products are not listed.
Mutsumi Kobayashi, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Human iPSCs were dissociated using Accutase (Innovative Cell Technologies, AT104) and suspended in mTeSR plus (Stemcell Technologies ...
-
No products found
because this supplier's products are not listed.
Rodney M. Ritzel, et al.,
bioRxiv - Neuroscience 2022
Quote:
... sections were mounted onto glass slides with coverslips using an anti-fade Hydromount solution (National Diagnostics). The following primary and secondary antibodies were used ...
-
No products found
because this supplier's products are not listed.
Kizhakke Mattada Sathyan, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... Os12t0613700-01) genes were codon optimized for humans and synthesized from Bio Basic Inc ...
-
No products found
because this supplier's products are not listed.
Lucia Pedicini, et al.,
bioRxiv - Cell Biology 2020
Quote:
... IDA data were searched against human database in ProteinPilot 4.5 (AB-SCIEX, Canada).
-
No products found
because this supplier's products are not listed.
Jasmine Alexander-Floyd, et al.,
bioRxiv - Immunology 2021
Quote:
... supernatants and recombinant cytokine standards were applied to anti-IL-1β antibody-coated (eBioscience) Immulon ELISA plates (ImmunoChemistry Technologies). IL-1β was detected using biotinylated anti IL-1β (eBioscience ...
-
No products found
because this supplier's products are not listed.
Hohyun Cho, et al.,
bioRxiv - Neuroscience 2021
Quote:
The implanted electrode grids were approved for human use (Ad-Tech Medical Corp., Racine, WI; and PMT Corp., Chanhassen, MN). The platinum-iridium electrodes were 4 mm in diameter (2.3 mm exposed) ...
-
No products found
because this supplier's products are not listed.
Magdalena Ziółkowska, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Squares of approximately 1 × 1 × 1 mm were attached to aluminium pins (Gatan metal rivets, Oxford instruments) with very little amount of cyanacrylamide glue ...
-
No products found
because this supplier's products are not listed.
Marie E Jönsson, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 1 mM DTT) using a 1 ml tissue douncer (Wheaton). The homogenate was carefully layered on top of a sucrose cushion (1.8 M sucrose ...
-
No products found
because this supplier's products are not listed.
Richard J Smith, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Images were acquired at 1×1 binning using a CoolSNAP HQ or HQ2 camera (Photometrics) and processed using softWorx software and ImageJ (National Institutes of Health) ...
-
No products found
because this supplier's products are not listed.
Maria Florencia Ercoli, et al.,
bioRxiv - Plant Biology 2022
Quote:
... 1% sucrose (pH 5.8) in 0.3% Gellex (Gellan Gum CAS#71010-52-1 Caisson Laboratories) supplemented with or without 1µM of the selected kinase inhibitor (see Supplemental Table S5 for a description of the compounds tested in this study) ...
-
No products found
because this supplier's products are not listed.
Daniela Saderi, Brad N. Buran, Stephen V. David,
bioRxiv - Neuroscience 2019
Quote:
... 1 to 4 high-impedance tungsten microelectrodes (FHC or A-M Systems, impedance 1-5 MΩ) were slowly advanced into cortex with independent motorized microdrives (Alpha-Omega) ...
-
No products found
because this supplier's products are not listed.
Eric A. Kirk, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Anesthesia was induced with isoflurane (1-5%, Kent Scientific), eye lubricant was applied ...