-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Jason Small, Alison Weiss,
bioRxiv - Microbiology 2021
Quote:
... Cells were washed with PBST and placed in primary antibody (Rabbit Anti-E. coli, cat. 1001, ViroStat, Rabbit Anti-Intimin ...
-
No products found
because this supplier's products are not listed.
Ellis L. Ryan, et al.,
bioRxiv - Cell Biology 2020
Quote:
... rabbit anti-chTOG (34032, QED Biosciences), mouse anti-TACC3 (ab56595 ...
-
No products found
because this supplier's products are not listed.
Stefanie Lübke, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... rabbit anti-β -Gal 1:5000 (Biotrend), rabbit anti-GFP 1:500 (abcam) ...
-
No products found
because this supplier's products are not listed.
Awatef Allouch, et al.,
bioRxiv - Immunology 2022
Quote:
... cell volumes and surfaces were measured by Volocity software (Quorum Technologies). For detection of CFSE+ and mCherry+ cells engrafted in mice tissues ...
-
No products found
because this supplier's products are not listed.
Jilong Qin, Yaoqin Hong, Makrina Totsika,
bioRxiv - Microbiology 2023
Quote:
... polysaccharide samples separated by SDS-tricine gel electrophoresis were transferred onto nitrocellulose membrane and detected with rabbit polyclonal anti-O16 antibodies (SSI Diagnostica, #SSI85012).
-
No products found
because this supplier's products are not listed.
BumJin Ko, et al.,
bioRxiv - Neuroscience 2022
Quote:
... rabbit anti-GFP (1:20, LF-PA0046, AbFrontier, South Korea) and goat anti-Drd4 (1:20 ...
-
No products found
because this supplier's products are not listed.
Elijah A. Petter, et al.,
bioRxiv - Neuroscience 2022
Quote:
... DV: 2.0 mm from skull surface) using a microinjector (Nanoject 3000, Drummond Scientific). Optic fibers (SFLC230-10 ...
-
No products found
because this supplier's products are not listed.
Toshiyuki Ueki, et al.,
bioRxiv - Synthetic Biology 2019
Quote:
... and the HA Tag Polyclonal Antibody as primary antibodies and an anti-mouse IgG-gold (40 nm) antibody (40 nm Goat Anti-Mouse IgG gold conjugate, Expedeon) and the anti-rabbit IgG-gold (10 nm ...
-
No products found
because this supplier's products are not listed.
Ika Dewi Ana,
bioRxiv - Bioengineering 2020
Quote:
... The surface of specimens were examined by type JSM 5400 LV (JEOL, Tokyo, Japan) scanning electron microscope (SEM ...
-
No products found
because this supplier's products are not listed.
Bettina Zens, et al.,
bioRxiv - Cell Biology 2023
Quote:
... CDMs were scraped off the cell culture dish surface with a cell scraper (Sarstedt, #83.1830) and the matrix was transferred into 1.5 ml centrifugation tubes.
-
No products found
because this supplier's products are not listed.
Linda S. Forero-Quintero, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... anti-Ser5ph-RNAP2 (MABI 0603) and anti-Ser2ph–RNAP2 (MABI 0602) monoclonal antibodies (Cosmo Bio USA) at 4°C overnight with rotation ...
-
No products found
because this supplier's products are not listed.
Drishya Kurup, et al.,
bioRxiv - Microbiology 2020
Quote:
The following antibodies were used in this study: Anti-ZIKV-E mouse monoclonal antibody (Biofront Technologies, 1176-56), Pan-Flavivirus-E 4G2 mouse monoclonal antibody produced from hybridoma cell line D1-4G2-4-15 (ATCC ...
-
No products found
because this supplier's products are not listed.
Alok Nath Mohapatra, et al.,
bioRxiv - Neuroscience 2023
Quote:
... The EAr was lowered onto the surface of the exposed brain using a motorized manipulator (MP200; Sutter instruments). The dorsoventral coordinates were marked using the depth of the electrode targeting the PVN (AP= -1 mm ...
-
No products found
because this supplier's products are not listed.
R Barbieri, et al.,
bioRxiv - Microbiology 2020
Quote:
... the paraffin sections were incubated with anti-glycophorin A antibody JC 159 (Mouse Monoclonal Antibody, ref: Mob 066-05, Diagnostic BioSystems, Nanterre, France) at a 1/500 dilution using a Ventana Benchmark autostainer (Ventana Medical Systems ...
-
No products found
because this supplier's products are not listed.
Ian F Bezar, et al.,
bioRxiv - Microbiology 2019
Quote:
... Defibrinated rabbit blood (Hemostat Laboratories) was washed by centrifuging cells at 1000 × g for 5 min followed by gently resuspending in ice-cold 1x PBS ...
-
No products found
because this supplier's products are not listed.
Liwei Yang, et al.,
bioRxiv - Bioengineering 2021
Quote:
... 50 μL of 1 mg/mL antibodies were reacted with 1 μL of 10 mM UV-cleavable azido-NHS ester (30 equivalents to antibodies; Click Chemistry Tools) for 2 h ...
-
No products found
because this supplier's products are not listed.
Zaki Al-Yafeai, et al.,
bioRxiv - Cell Biology 2020
Quote:
Low density lipoprotein was purchased from Alfa Aesar and oxidized using 13.8 mM copper sulfate as previously described(8) ...
-
No products found
because this supplier's products are not listed.
Bradley M. Roberts, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Primary antibodies: rabbit anti-NeuN (1:500, Biosensis, R-3770–100). Sections were then incubated in species-appropriate fluorescent secondary antibodies with minimal cross-reactivity for 2 hours in PBS-Tx with 2% NDS at room temperature ...
-
No products found
because this supplier's products are not listed.
Vadim Fedyuk, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... Biotinylated antibodies were incubated on surface in IMB2 [10 mM MES pH 6.5 (Boston Bioproducts Inc, NC9904354), 60 mM KCL ...
-
No products found
because this supplier's products are not listed.
Fatima Amer-Sarsour, et al.,
bioRxiv - Cell Biology 2022
Quote:
... rabbit anti-α-Fetoprotein (ScyTek A00058); rabbit anti-α-smooth muscle actin (Abcam 32575) ...
-
No products found
because this supplier's products are not listed.
Vera Kovaleva, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Cells were incubated overnight at +4°C with the following primary antibodies: anti-MANF rabbit pAb (Icosagen, 310-100), anti-IRE1α rabbit mAb (CST ...
-
No products found
because this supplier's products are not listed.
Benjamin Ng, et al.,
bioRxiv - Immunology 2022
Quote:
... anti-IL11 antibody (X203, Aldevron), IgG antibody (IIE10 ...
-
No products found
because this supplier's products are not listed.
Roberto Frigerio, et al.,
bioRxiv - Biochemistry 2020
Quote:
... anti-CD63-Biotin and anti-CD81-Biotin antibodies (Ancell) 0.1mg/mL for 1 hour ...
-
No products found
because this supplier's products are not listed.
José Ignacio Gallea, et al.,
bioRxiv - Biophysics 2024
Quote:
... T4 samples were first incubated with a 1:50 solution of rabbit anti-wac (fibritin) antibody (2.95 mg/ml; CUSABIO, No. CSB-PA319157ZA01EDZ) in blocking solution for 1 hour ...
-
Rabbit polyclonal antibody to p27 Kip1
Cat# CPA4597,
200 ul USD $350.0, 100 ul USD $220.0, 30 ul USD $110.0
Ask
Yingjuan Liu, et al.,
bioRxiv - Genetics 2020
Quote:
... or goat-anti-rabbit H&L FITC (Cohesion Biosciences), with a dilution of 1:200.
-
No products found
Shaowen White, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 1:500 mouse anti-VP5 antibody (Biodesign), or 1:250 chicken anti-UL34 antiserum (Reynolds et al. ...
-
No products found
because this supplier's products are not listed.
Elva Vidya, et al.,
bioRxiv - Molecular Biology 2024
Quote:
... anti CGH-1 (Rabbit #7199 production bleed 1:2000) (Capralogics). Commercial primary antibodies used were listed in Table S2 (Antibodies tab).
-
No products found
because this supplier's products are not listed.
Aurore C. A. Gay, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and cell surface protein libraries were sequenced on the NextSeq 550 System (Illumina).
-
No products found
because this supplier's products are not listed.
Lei Liu, et al.,
bioRxiv - Immunology 2022
Quote:
... The following antibodies were used: anti-CD11b (Biogems, CA), anti-F4/80 (Biolegend ...
-
No products found
because this supplier's products are not listed.
Emily E. Whitaker, et al.,
bioRxiv - Microbiology 2019
Quote:
... Rabbit polyclonal antibody (pAb) to HIV-1 p24 was obtained from Advanced Biotechnologies (Cat. #13-203-000). Secondary antibodies were as follows ...
-
No products found
because this supplier's products are not listed.
Liqiang Chen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... −2.6 mm from the brain surface) using a 10-μl syringe (Hamilton) driven by a motorized microinjector (Stoelting) at a rate of 0.2 μl/min ...
-
No products found
because this supplier's products are not listed.
Hoyun Kwak, et al.,
bioRxiv - Genetics 2020
Quote:
... Vectors that encoded the anti-FAM19A5-IgG1 antibody were transfected into HEK293F cells and the recombinant antibody was purified using Protein A beads (RepliGen). Anti-FAM19A5 antibodies that recognized the epitopes formed at N-terminal and C-terminal regions were generated and called N-A5-Ab and C-A5-Ab ...
-
No products found
because this supplier's products are not listed.
Friederike Gutmann, et al.,
bioRxiv - Microbiology 2020
Quote:
... Plate reader assays were performed under oxygen-limited conditions in 96-well plates (Nunclon Delta Surface, Thermo Scientifc) with Synergy HTX Multi-Detection Microplate Readers (BioTek) at 30°C ...
-
No products found
because this supplier's products are not listed.
Natàlia de Martín Garrido, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Samples of ΦKZ nvRNAP were adsorbed to a thin film of graphene oxide deposited upon the surface of holey carbon copper grids (R2/1, 300 mesh, Quantifoil). Grids were blotted for 1-2 seconds before plunge freezing in liquid ethane using a Vitrobot Mark IV (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Xi Chen, et al.,
bioRxiv - Bioengineering 2021
Quote:
... Liver slides were stained with goat-anti-hFIX antibody (1:2000, Affinity Biologicals, GAFIX-AP). Subsequently ...
-
No products found
because this supplier's products are not listed.
NC Rodgers, et al.,
bioRxiv - Cell Biology 2022
Quote:
... for 1 h and incubated overnight with primary antibodies: anti-rat CLASP1 (KT 67, Absea), anti-rat CLASP2 (KT69 ...
-
No products found
because this supplier's products are not listed.
Elsa Mazari-Arrighi, et al.,
bioRxiv - Bioengineering 2021
Quote:
... rabbit anti-rat albumin antibody (RaRa/ALB/7S, Nordic-MUbio, Netherlands) was used as primary antibody and biotinylated goat anti-rabbit antibody (VECTASTAIN Elite ABC HRP Kit ...
-
No products found
because this supplier's products are not listed.
Katrina L. Randall, et al.,
bioRxiv - Immunology 2023
Quote:
... Surface stain panel H-2Kb/SSIEFARL dextramer (Immudex), anti-CD8 (clone 53-6.7 ...
-
No products found
because this supplier's products are not listed.
Rida Rehman, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Rabbit anti-HELLS (1:100, Antibodies.com), Rat anti-Vitronectin (1:100 ...
-
No products found
because this supplier's products are not listed.
Susanne Hellmuth, Olaf Stemmann,
bioRxiv - Cell Biology 2024
Quote:
... rabbit anti- histone H2A (1:1,000; 11-7017, Abeomics), rabbit anti-pS10-histone H3 (1:1,000 ...
-
No products found
because this supplier's products are not listed.
Han-Wei Shih, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Alexa 647-conjugated anti-CWP1 antibody (Waterborne, New Orleans, LA) was used at 1:2,000 ...
-
No products found
because this supplier's products are not listed.
Augusto Escalante, Rüdiger Klein,
bioRxiv - Neuroscience 2020
Quote:
... The plantar surface of the hindpaw stimulated with an Austerlitz insect pin (0.02 mm; Fine Science Tools). Stimulation was repeated 10 times on alternating sides and the percentage of paw withdrawal were calculated.
-
No products found
because this supplier's products are not listed.
Kamal Mandal, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... The beads bound with biotinylated cell surface proteins were resuspended in 50 mM Tris (pH 8.5) + 4 M urea + 10 mM TCEP (Gold Biotechnology, TCEP10) and 20 mm IAA (VWR ...
-
No products found
because this supplier's products are not listed.
Swastik Phulera, et al.,
bioRxiv - Biophysics 2024
Quote:
... The virus titer was determined by gp64-PE mouse anti-baculovirus antibody (Expression Systems, CA) using a Guava benchtop Flow Cytometer (Millipore ...
-
No products found
because this supplier's products are not listed.
Valentina Rossio, et al.,
bioRxiv - Biochemistry 2020
Quote:
Commercial antibodies used for Western blotting analysis were as follow: anti-Ube2C (A-650, Boston Biochem), anti-ubiquitin (P4D1 ...
-
No products found
because this supplier's products are not listed.
Lanlan Bai, et al.,
bioRxiv - Microbiology 2019
Quote:
... the cells were incubated with a primary anti-Env monoclonal antibody (Mab, BLV-1; VMRD, Pullman, WA) followed by incubation with Alexa Fluor 594 goat anti-mouse IgG (Invitrogen) ...
-
No products found
because this supplier's products are not listed.
Júlia Vallvé-Juanico, et al.,
bioRxiv - Immunology 2022
Quote:
... the antibodies were resuspended with Antibody Stabilizer (Boca Scientific, Dedham, MA, USA) at a concentration of 0.2 mg/ml and stored at 4°C ...
-
No products found
because this supplier's products are not listed.
Sebastian Boland, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Primary antibodies against the following targets were used in the present study: GM2 monoclonal antibody (TCI America, Cat#A2576), human progranulin (R&D systems ...
-
No products found
because this supplier's products are not listed.
Sharon S. Newman, et al.,
bioRxiv - Bioengineering 2023
Quote:
dAbs were generated by conjugating amine-modified oligonucleotides (15–25 OD260 units) to polyclonal antibodies (100 µg) using the Antibody-Oligonucleotide All-in-One Conjugation Kit from TriLink Biotechnologies (A-9202) ...