-
No products found
because this supplier's products are not listed.
Jian Xing, et al.,
bioRxiv - Neuroscience 2022
Quote:
... axons were visualized at 2 weeks after optic nerve injury by immunostaining with the anti-CTB antibody (1:500; rabbit, GWB-7B96E4, GenWay) and fluorescent dye-conjugated secondary antibodies (1:500 ...
-
Cat# FL-04,
500 micrograms,USD $303.0
Ask
Hartwig Seitter, et al.,
bioRxiv - Neuroscience 2020
Quote:
The rabbit polyclonal anti-melanopsin antibody (Advanced Targeting Systems Cat# AB-N39, RRID:AB_1608076) was generated against the 15 N-terminal extracellular amino acids of mouse melanopsin ...
-
No products found
because this supplier's products are not listed.
Ben Nicholas, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 2 mg of anti-MHC-I mouse monoclonal antibodies (W6/32) covalently conjugated to Protein A sepharose (Repligen) using DMP as previously described [42,43] were added to the clarified supernatants and incubated with constant agitation for 2 h at 4°C ...
-
No products found
because this supplier's products are not listed.
Stefanie Lübke, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... rabbit anti-β -Gal 1:5000 (Biotrend), rabbit anti-GFP 1:500 (abcam) ...
-
No products found
because this supplier's products are not listed.
Emma Haley, et al.,
bioRxiv - Immunology 2021
Quote:
... Antibodies for surface markers (Table 1) were added in staining buffer (HBSS with 2 mM EDTA (Boston Bioproducts) and 0.5 % bovine serum albumin (Sigma) ...
-
No products found
because this supplier's products are not listed.
Caleb R. Carr, et al.,
bioRxiv - Microbiology 2024
Quote:
... 2 µL of 10 µM 5’ PacBio round 2 forward primer (PacBio_5pri_RND2), 2 µL of 10 µM 3’ PacBio round 2 reverse primer (PacBio_3pri_RND2) ...
-
No products found
because this supplier's products are not listed.
Megan Clapperton, et al.,
bioRxiv - Biophysics 2023
Quote:
... and fluorescence (PMT 2).
-
No products found
because this supplier's products are not listed.
Mansi Prakash, et al.,
bioRxiv - Neuroscience 2021
Quote:
... containing 2 mg/ml papain (BrainBits). Papain solution was removed ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... and GST antibody (Tiangen).
-
2 Well Chambered Cover Glass with #1.5 high performance cover glass (0.170±0.005mm), with lid,...
Cat# C2-1.5H-N,
48/case, $219.00
Ask
Laura R Lee, et al.,
bioRxiv - Plant Biology 2023
Quote:
... 5 mL of 1/2 MS with 2% low melt agarose was cast into imaging cuvettes (CellVis product number #C1-1.5H-N) after being filtered through a 0.45 micron nylon filter to remove any particulates that might disturb the path of the light sheet to prepare media “blankets” ...
-
No products found
because this supplier's products are not listed.
Karen Acuña Pilarte, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... and 2% Cholesterol (D09100301, Research diets Inc, New Brunswick NJ) with drinking water also supplemented with 23.1 g/L of D-fructose and 18.9g/L D-glucose (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Aswini Panigrahi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Anti-Sulf-2 monoclonal antibodies (QED Bioscience), Anti-LG3BP monoclonal antibody (Proteintech) ...
-
No products found
because this supplier's products are not listed.
Verica Vasić, et al.,
bioRxiv - Neuroscience 2022
Quote:
... As primary antibody a polyclonal rabbit anti-human EGFL7 antibody (1:50, ReliaTech GmbH) was applied ...
-
No products found
because this supplier's products are not listed.
Annu Nummi, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Secondary antibody was an HRP-polymer anti-rabbit antibody (BiositeHisto Nordic Biosite cat. no KDB-Z47C3W). Immunoreactivity of antibodies was controlled in sections of porcine kidney ...
-
No products found
because this supplier's products are not listed.
Sankalp Shukla, et al.,
bioRxiv - Cell Biology 2022
Quote:
... ALG-2 was detected using the PDCD6 Rabbit Polyclonal Antibody (no. 12303-1-AP, Thomas Scientific), ALIX ...
-
No products found
because this supplier's products are not listed.
Ludmila Recoules, et al.,
bioRxiv - Genomics 2021
Quote:
... Rabbit anti- mH2A1.1 antibody was generated according to immunization protocol from Agro-Bio - La fierté Saint-Aubin – France ...
-
No products found
because this supplier's products are not listed.
Geraldine Nouailles, et al.,
bioRxiv - Immunology 2022
Quote:
... and rabbit anti hamster IgA antibody (Brookwood Biomedical, Jemison, AL, dilution: 1:250) were incubated at 4°C overnight followed by washing and incubation with a secondary biotinylated goat anti-mouse IgG antibody (dilution ...
-
No products found
because this supplier's products are not listed.
Yann Ehinger, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Rabbit anti-VGUT1 antibody (VGT1-3) was purchased from Mab Technologies (Stone Mountain, GA). Other common reagents were from Sigma Aldrich (St ...
-
No products found
because this supplier's products are not listed.
Fan Bu, et al.,
bioRxiv - Cell Biology 2023
Quote:
... The secondary fluorescent antibodies was Goat anti rabbit (1:1000, L114A, GeneCopoeia, United States). Nuclei were stained with DAPI (4’,6-diamidino-2-phenylindole ...
-
No products found
because this supplier's products are not listed.
Yong Fu, et al.,
bioRxiv - Microbiology 2021
Quote:
... rabbit anti-tRFP (Axxora), mouse anti-6XHis (mAbHIS.H8 ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Jason Small, Alison Weiss,
bioRxiv - Microbiology 2021
Quote:
... Cells were washed with PBST and placed in primary antibody (Rabbit Anti-E. coli, cat. 1001, ViroStat, Rabbit Anti-Intimin ...
-
No products found
because this supplier's products are not listed.
Benjamin Ng, et al.,
bioRxiv - Immunology 2022
Quote:
... anti-IL11 antibody (X203, Aldevron), IgG antibody (IIE10 ...
-
No products found
because this supplier's products are not listed.
Jack George, Howard T. Jacobs,
bioRxiv - Molecular Biology 2019
Quote:
... custom rabbit polyclonal antibodies (21st Century Biochemicals, both 1:5000), GAPDH (Everest Biotech EB06377 ...
-
No products found
because this supplier's products are not listed.
Shoshik Amram, et al.,
bioRxiv - Neuroscience 2019
Quote:
... rabbit anti-p15 (1:50, Assay Biotechnology, # C0287), rabbit anti-laminb1 (1:200 ...
-
No products found
because this supplier's products are not listed.
José Ignacio Gallea, et al.,
bioRxiv - Biophysics 2024
Quote:
... T4 samples were first incubated with a 1:50 solution of rabbit anti-wac (fibritin) antibody (2.95 mg/ml; CUSABIO, No. CSB-PA319157ZA01EDZ) in blocking solution for 1 hour ...
-
No products found
because this supplier's products are not listed.
BumJin Ko, et al.,
bioRxiv - Neuroscience 2022
Quote:
... rabbit anti-GFP (1:20, LF-PA0046, AbFrontier, South Korea) and goat anti-Drd4 (1:20 ...
-
No products found
because this supplier's products are not listed.
Toshiyuki Ueki, et al.,
bioRxiv - Synthetic Biology 2019
Quote:
... and the HA Tag Polyclonal Antibody as primary antibodies and an anti-mouse IgG-gold (40 nm) antibody (40 nm Goat Anti-Mouse IgG gold conjugate, Expedeon) and the anti-rabbit IgG-gold (10 nm ...
-
No products found
because this supplier's products are not listed.
Lei Liu, et al.,
bioRxiv - Immunology 2022
Quote:
... The following antibodies were used: anti-CD11b (Biogems, CA), anti-F4/80 (Biolegend ...
-
No products found
because this supplier's products are not listed.
Fangzhu Zhao, et al.,
bioRxiv - Bioengineering 2022
Quote:
... 15 uL of each antibody at 2 mg/mL was injected into the TSKgel SuperSW mAb column (Tosoh) with the flow rate of 1 mL/min.
-
No products found
because this supplier's products are not listed.
Kenji Watari, et al.,
bioRxiv - Neuroscience 2023
Quote:
... The primary antibodies used were as follows: anti-Chx10 (sheep; 1:500; Exalpha), anti-Pax6 (mouse ...
-
No products found
because this supplier's products are not listed.
Swapneeta S. Date, et al.,
bioRxiv - Cell Biology 2021
Quote:
... VU101: Anti-ubiquitin Antibody (VU-0101, 1:1000) was purchased from LifeSensors (PA, USA). Anti-mouse HRP conjugate (W4021 ...
-
No products found
because this supplier's products are not listed.
R Barbieri, et al.,
bioRxiv - Microbiology 2020
Quote:
... the paraffin sections were incubated with anti-glycophorin A antibody JC 159 (Mouse Monoclonal Antibody, ref: Mob 066-05, Diagnostic BioSystems, Nanterre, France) at a 1/500 dilution using a Ventana Benchmark autostainer (Ventana Medical Systems ...
-
No products found
because this supplier's products are not listed.
Ian F Bezar, et al.,
bioRxiv - Microbiology 2019
Quote:
... Defibrinated rabbit blood (Hemostat Laboratories) was washed by centrifuging cells at 1000 × g for 5 min followed by gently resuspending in ice-cold 1x PBS ...
-
No products found
because this supplier's products are not listed.
Hao Liu, et al.,
bioRxiv - Biochemistry 2019
Quote:
... 2-amino-N-(2-aminoethyl)-benzamide (AEAB) was purchased from Chem-Impex International (Wood Dale ...
-
No products found
because this supplier's products are not listed.
Xiaoxuan Lin, et al.,
bioRxiv - Biophysics 2023
Quote:
... and hand-packing into a column (2 mm ID × 2 cm, IDEX C-130B). After digestion ...
-
LDH-A inhibitor
Sold for research purposes only.
Cat# 2450.0, SKU# 2450-5 mg,
5mg, US $99.00 / EA, EURO, €90 / EA
Ask
Irene Zorzan, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... 2 μM Gö6983 (Axon Medchem) and 10 ng/ml human LIF (produced in-house) ...
-
No products found
because this supplier's products are not listed.
Florian Franz, et al.,
bioRxiv - Biophysics 2022
Quote:
... pFN18a (Ig32)2-(R3IVVI)-(Ig32)2 was subcloned into a modified pFN18a vector engineered with the AviTagTM (Avidity) (sequence GLNDIFEAQKIEWHE) ...
-
Gemcitabine, Free Base (dFdC, dFdCyd, Gamcitabine, Gemcitera, Gemsar, Gemzar, LY-188011, 2'-Deoxy-2',2'-difluorocytidine, Zefei, CAS 95058-81-4), >99%
LC Laboratories' Product Number G-4199 - Gemcitabine, Free Base (dFdC, dFdCyd, Gamcitabine,...
Cat# G-4199, SKU# G-4199_100mg,
100 mg, $39.00
Ask
Jing Fan, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 2 µM Olaparib (LC laboratories, O-9201) and 20 nM BMN673 (Selleckchem ...
-
No products found
because this supplier's products are not listed.
Galen J. Correy, et al.,
bioRxiv - Biochemistry 2022
Quote:
The gene encoding SARS-CoV-2 2-170 NSP3 Mac1 was cloned into a pET-11a plasmid (Bio Basic) and transformed into E ...
-
No products found
because this supplier's products are not listed.
Leah M. Williams, et al.,
bioRxiv - Cell Biology 2019
Quote:
... a piece of tissue approximately 2 cm by 2 cm was placed into a glass dounce tissue grinder (Wheaton USA) with 1 ml of AT Lysis Buffer and protease inhibitors (described above) ...
-
No products found
because this supplier's products are not listed.
P. R. V. Satyaki, Mary Gehring,
bioRxiv - Plant Biology 2019
Quote:
... seeds were sterilized in 2% PPM (Plant Cell Technologies) for three days at 4°C and then plated on 0.5X MS/Phytagar media ...
-
No products found
because this supplier's products are not listed.
Inês Caldeira Brás, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and then incubated with 2% BSA in PBS (NZYTech) blocking solution for 1h at RT ...
-
No products found
because this supplier's products are not listed.
Juan Yang, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Sulfo-Cyanine 3 Azide (2-5 uM final, Lumiprobe, #D1330), and fresh Sodium Ascorbate (100 mM final ...
-
No products found
because this supplier's products are not listed.
Sushant Bhat, et al.,
bioRxiv - Microbiology 2021
Quote:
... (ID Vet) and Influenza A Antibody ELISA (IDEXX) were performed according to manufacturers’ instructions.
-
No products found
because this supplier's products are not listed.
Eamim Daidrê Squizani, et al.,
bioRxiv - Microbiology 2020
Quote:
... and homogenized in 2 ml sterile PBS using a BeadBug (Benchmark Scientific). Organ homogenates were serially diluted and plated onto Sabouraud dextrose agar plates ...
-
No products found
because this supplier's products are not listed.
Bekir Altas, et al.,
bioRxiv - Neuroscience 2019
Quote:
... in 2 ml eppendorf tubes by using Ultra Turrax homogenizer (IKA Labtechnik) for 40 seconds and incubated at the room temperature for 3 min ...
-
No products found
because this supplier's products are not listed.
Olha Zapukhliak, et al.,
bioRxiv - Neuroscience 2020
Quote:
... amplified using a 2-channel differential amplifier M1800 (A-M Systems, Carlsborg, WA), digitized at 10 kHz using an analog-to-digital converter (NI PCI-6221 ...
-
No products found
because this supplier's products are not listed.
Zhuo Wang, et al.,
bioRxiv - Animal Behavior and Cognition 2020
Quote:
... Carprofen (2 mg in 5 g tablet, p. o., Bio-Serv, Flemington, NJ, USA) was administered for one day preoperatively and for two days postoperatively for analgesia ...
-
No products found
because this supplier's products are not listed.
Isabella A. Bagdasarian, et al.,
bioRxiv - Bioengineering 2023
Quote:
... 2 pieces of tubing (0.07” outer diameter, 18” long, Cole-Parmer, Vernon Hills, IL) and 2 18 ga ...