-
No products found
because this supplier's products are not listed.
Esther B. Florsheim, et al.,
bioRxiv - Immunology 2023
Quote:
... or rabbit polyclonal anti-Fluoro-Gold primary antibody (1:1000 Fluorochrome) in the same blocking solution overnight for 16 h and then with Alexa Fluor 594-conjugated donkey anti-rabbit IgG secondary fluorescent antibody (1:500 dilution ...
-
No products found
because this supplier's products are not listed.
Ram Jha, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... PBMCs were activated using anti-CD3 antibody and anti-CD28 antibody (Miltenyi Biotec). 24 hr post activation ...
-
No products found
because this supplier's products are not listed.
Robin Roychaudhuri, et al.,
bioRxiv - Biochemistry 2022
Quote:
... rabbit anti SLC7A10 polyclonal antibody (G-Biosciences; ITA8971).
-
No products found
Jennifer Hampton Hill, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... an anti-His rabbit polyclonal antibody (ABM, Richland, BC, Canada) in combination with a polyclonal goat anti-rabbit HRP conjugated secondary antibody (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Jack George, Howard T. Jacobs,
bioRxiv - Molecular Biology 2019
Quote:
... custom rabbit polyclonal antibodies (21st Century Biochemicals, both 1:5000), GAPDH (Everest Biotech EB06377 ...
-
No products found
because this supplier's products are not listed.
Xiangyu Gao, et al.,
bioRxiv - Genetics 2024
Quote:
... the goat anti-rabbit IgG antibody (Solarbio, Beijing, China) coupled with secondary fluorescein isothiocyanate was used for green fluorescence detection ...
-
No products found
because this supplier's products are not listed.
Danielle L Tomasello, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Primary antibodies (MAP2 anti-chicken Encor Biotechnology CPCA-MAP2, GFAP anti-rabbit), secondary antibodies (488 anti-chicken Jackson 703-545-155 ...
-
No products found
because this supplier's products are not listed.
Khem Raj Giri, et al.,
bioRxiv - Immunology 2020
Quote:
... polyclonal rabbit anti-calnexin antibody (1:1000; Euromedex, Souffelweyersheim, France), β–actin (W16197A ...
-
No products found
because this supplier's products are not listed.
Alexis M. Crockett, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Primary antibodies polyclonal rabbit anti-rat/mouse fibrinogen (1:300; Innovative research), polyclonal rabbit anti-mouse/human claudin-5 (1:300 ...
-
No products found
because this supplier's products are not listed.
Javier Martínez Pacheco, et al.,
bioRxiv - Plant Biology 2022
Quote:
... Rabbit AtTOR polyclonal antibodies (Abiocode, R2854-2), rabbit polyclonal S6K1/2 antibodies (Agrisera ...
-
No products found
because this supplier's products are not listed.
Hong Liu, et al.,
bioRxiv - Microbiology 2023
Quote:
... and stained with a rabbit polyclonal anti- Aspergillus antibody (Meridian Life Science, Inc.) followed by an AlexaFluor 568-labeled goat anti-rabbit antibody (Life Technologies) ...
-
No products found
because this supplier's products are not listed.
Monique Liebers, et al.,
bioRxiv - Plant Biology 2020
Quote:
... Rabbit polyclonal antibodies against PAP8 were produced by ProteoGenix. In Western blots PAP8 is detected at ~38 kDa ...
-
No products found
because this supplier's products are not listed.
Luke W Thomas, et al.,
bioRxiv - Cell Biology 2019
Quote:
... The rabbit polyclonal CHCHD4 (HPA034688) antibody was purchased from Cambridge Biosciences. The rabbit polyclonal NDUFB10 (ab196019) ...
-
No products found
because this supplier's products are not listed.
Xiaojie Ji, et al.,
bioRxiv - Genetics 2021
Quote:
Antibodies against phospho-MERTK (FabGennix, PMKT-140AP, rabbit polyclonal, 1:750), 4-HNE (Abcam ...
-
No products found
because this supplier's products are not listed.
Brian Foo, et al.,
bioRxiv - Cell Biology 2024
Quote:
... polyclonal rabbit α-SERCA2a (Badrilla) and rabbit α-RyR2 (Sigma) ...
-
No products found
because this supplier's products are not listed.
Wadie D. Mahauad-Fernandez, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... goat anti-rabbit or goat anti-mouse secondary antibodies (Protein Simple). All antibody incubation and wash steps were programmed and performed automatically in the Peggy Sue® system ...
-
No products found
because this supplier's products are not listed.
Emily Speranza, et al.,
bioRxiv - Immunology 2021
Quote:
... A mixture of anti-Mouse + anti-Rabbit HRP-conjugated secondary antibodies (Akoya Biosciences) was added for 10 minutes ...
-
No products found
because this supplier's products are not listed.
Yury Bykov, et al.,
bioRxiv - Cell Biology 2019
Quote:
... incubated for 45 minutes with goat anti-rabbit 15nm gold antibody (EMS) diluted 1:20 in filtered blocking solution ...
-
No products found
because this supplier's products are not listed.
Prakash Thapa, et al.,
bioRxiv - Immunology 2019
Quote:
... anti-Vα24 antibody (Beckman Coulter), and anti-CD3 and anti-CD4 antibodies (eBioscience).
-
No products found
because this supplier's products are not listed.
Junko Yoshida, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... and anti-Nanog rabbit polyclonal antibody (1:200, Cat. RCAB002P-F, ReproCELL). Alexa Fluor 488-conjugated goat anti-mouse IgG (Cat ...
-
Cat# AB-12,
100 microliters,USD $400.0
Ask
Hartwig Seitter, et al.,
bioRxiv - Neuroscience 2020
Quote:
The rabbit polyclonal anti-melanopsin antibody (Advanced Targeting Systems Cat# AB-N39, RRID:AB_1608076) was generated against the 15 N-terminal extracellular amino acids of mouse melanopsin ...
-
No products found
because this supplier's products are not listed.
Lucas E. Cabrera Zapata, et al.,
bioRxiv - Neuroscience 2022
Quote:
... or anti-Npy rabbit polyclonal antibody (T-4070, Peninsula Laboratories-BMA Biomedicals, Switzerland). After rinsing with PBS ...
-
No products found
because this supplier's products are not listed.
Elahe Zarini-Gakiye, et al.,
bioRxiv - Neuroscience 2020
Quote:
... rabbit anti GRP87/Bip polyclonal antibody (1:600, StressMarq Biosciences, Catalogue no. SPC-180), mouse anti-ATF6 monoclonal antibody (1:750 ...
-
No products found
because this supplier's products are not listed.
Yijiun Zhang, Joachim Seemann,
bioRxiv - Cell Biology 2023
Quote:
... 5 µl rabbit polyclonal anti- GM130 serum (Wei and Seemann, 2009b) or 1 µg rabbit IgG (ImmunoReagents) as control ...
-
No products found
because this supplier's products are not listed.
Tetsuya Miyamoto, et al.,
bioRxiv - Neuroscience 2023
Quote:
... rabbit anti-NPF (RayBiotech), mouse anti-Orcokinin-A (gift from Dr ...
-
No products found
because this supplier's products are not listed.
VG LeBlanc, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Rabbit anti-GFAP (STEMCELL Technologies; 1:500); Mouse anti-Beta Tubulin (STEMCELL Technologies ...
-
No products found
because this supplier's products are not listed.
Curtis Cai, et al.,
bioRxiv - Immunology 2021
Quote:
... anti-CD3 antibody (Mabtech, Sweden), and three negative control wells with media only ...
-
No products found
because this supplier's products are not listed.
Hiroaki Itakura, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... anti-rabbit polyclonal antibody against S-100 (#422091, NICHIREI BIOSCIENCE Inc., Tokyo, Japan), anti-rabbit polyclonal antibody against CD45R (#14-0451-82 ...
-
No products found
because this supplier's products are not listed.
Ana Joaquina Jimenez, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Cryosections were incubated with a rabbit polyclonal anti-Biotin antibody (Rockland/Tebu-Bio) followed by protein A-10nm gold conjugate (CMC ...
-
Cat# AG149-1,
USD $95.0/ml
Ask
Shaowen White, My Tran, Richard J. Roller,
bioRxiv - Cell Biology 2022
Quote:
... mouse polyclonal anti-gE antibody (Virusys) 1:500 ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Jaqueline S. Generoso, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Rabbit polyclonal anti-capsule serotype 3 antiserum (SSI Diagnostica) followed by Alexa Fluor 594 goat anti-rabbit (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Ana Bello-Gamboa, et al.,
bioRxiv - Immunology 2020
Quote:
... Rabbit polyclonal anti-phospho-Thr538 paxillin for WB and immunofluorescence (ECM Biosciences). Rabbit polyclonal Phospho-(Ser ...
-
No products found
because this supplier's products are not listed.
Zachary T. Morrow, John-Demian Sauer,
bioRxiv - Immunology 2022
Quote:
... 100 µL rabbit-α-mouse IFN-β polyclonal antibody (PBL assay science, #32400-1) at 1:2000 dilution in blocking buffer was added and the plate was incubated for 2 hours at room temperature ...
-
No products found
because this supplier's products are not listed.
Huilei Wang, et al.,
bioRxiv - Physiology 2023
Quote:
... COLIV rabbit polyclonal (Assay Biotech C0157), beta Actin Loading Control Monoclonal Antibody (Invitrogen ...
-
No products found
because this supplier's products are not listed.
Alejandro Orrico-Sanchez, et al.,
bioRxiv - Neuroscience 2023
Quote:
... OCT2 was detected using rabbit polyclonal antibodies (1/500; Agro-Bio, La Ferte St Aubin, France) validated in previous studies [37] ...
-
No products found
because this supplier's products are not listed.
Jonas M. Holzinger, et al.,
bioRxiv - Microbiology 2023
Quote:
... or polyclonal anti-human BPI antibody (Cat# HM2170, RRID: AB_532911; Hycult Biotech, Uden, Netherlands) were incubated overnight at 4 °C ...
-
No products found
because this supplier's products are not listed.
Olena Kim, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Secondary antibodies goat anti-rabbit 5-nm gold conjugated (BBI Solutions, Cat # EM GAR5, RRID:AB_1769142) and goat anti-guinea pig 10-nm gold conjugated (BBI Solutions ...
-
No products found
because this supplier's products are not listed.
Glennis A. Logsdon, et al.,
bioRxiv - Genomics 2020
Quote:
... and then incubated with a mouse monoclonal anti-CENP-A antibody (1:200, Enzo, ADI-KAM-CC006-E) and rabbit monoclonal anti-5-methylcytosine antibody (1:200, RevMAb, RM231) for 3 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Souad Amiar, et al.,
bioRxiv - Microbiology 2019
Quote:
... Primary antibodies used: Mouse anti-HA antibody (InvivoGen, 1:1000), rabbit anti-ACP (1:2000) ...
-
No products found
because this supplier's products are not listed.
Yusuf Cem Eskiocak, et al.,
bioRxiv - Immunology 2021
Quote:
... Anti-mouse CD16/32 (2.4G2) antibody (Tonbo Biosciences, USA) or Human TruStain FcX (BioLegend ...
-
No products found
because this supplier's products are not listed.
Rehab El-Shehawy, et al.,
bioRxiv - Microbiology 2021
Quote:
... we used Rabbit-polyclonal antibodies against TH (50997, Nordic BioSite; previously used to identify dopaminergic neurons in D ...
-
No products found
because this supplier's products are not listed.
Francesca Pischedda, et al.,
bioRxiv - Neuroscience 2020
Quote:
Affinity-purified anti-P-Thr645-NSF polyclonal antibody was made in a NZW female rabbit (Envigo) by immunization against a single peptide (amino acids 631–656 ...
-
No products found
because this supplier's products are not listed.
Trevor J. Edwards, Jennifer L. Edwards,
bioRxiv - Microbiology 2022
Quote:
... Western Blots were probed with anti-C3 polyclonal antibody (Quidel).
-
No products found
because this supplier's products are not listed.
Kazuhito Honjo, et al.,
bioRxiv - Immunology 2019
Quote:
... Rabbit anti-FCRL6 polyclonal Abs were generated by hyperimmunizing New Zealand White rabbits (Charles River Laboratories) with Escherichia coli-derived His-tagged recombinant protein.
-
No products found
because this supplier's products are not listed.
Anil G Cashikar, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Goat anti-rabbit HRP secondary antibody (Leinco Technologies, R115); Goat Anti-rabbit Alexa 555 (Invitrogen ...
-
No products found
because this supplier's products are not listed.
MU Wagenhäuser, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... For the platelet depletion experiments mice were injected with platelet depletion antibody (Emfret Analytics, polyclonal anti-GPIb alpha #R300) and a corresponding IgG antibody (Emfret Analytics ...
-
No products found
because this supplier's products are not listed.
José Luis Garrido-Huarte, et al.,
bioRxiv - Microbiology 2022
Quote:
... The following primary antibodies were used in this work: Rabbit anti-GFP (TP401, Amsbio), mouse anti-flag (M2 ...
-
No products found
because this supplier's products are not listed.
Boris Bonaventure, et al.,
bioRxiv - Microbiology 2021
Quote:
... or J2 anti-dsRNA antibody (SCICONS), or anti-SARS-CoV-2 Nucleoprotein (N ...
-
No products found
because this supplier's products are not listed.
Junke Liu, et al.,
bioRxiv - Cell Biology 2024
Quote:
... or anti-AP2-Tb antibody (Revvity Cisbio) at final concentration of 0.5 nM for 2 h ...