-
No products found
because this supplier's products are not listed.
Maximilian Seurig, et al.,
bioRxiv - Biochemistry 2019
Quote:
... for blocking with AMS (Setareh Biotech), NEM ...
-
No products found
because this supplier's products are not listed.
Eric Hee Jun Lee, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Membranes were then blocked for 1 hour at room temperature in blocking buffer containing 5% PhosphoBLOCKER blocking reagent (Cell Biolabs) in TBST ...
-
No products found
because this supplier's products are not listed.
Robin S. Lindsay, et al.,
bioRxiv - Immunology 2021
Quote:
... 1µg/ml of 8.3 peptide (KYNKANVEL) (Chi Scientific), or 100ng/ml of OT-I peptide (SIINFEKL ...
-
No products found
because this supplier's products are not listed.
Chad R. Simmons, et al.,
bioRxiv - Bioengineering 2023
Quote:
... prepared in the laboratory using an adaption of a previously described protocol.58 Peptide synthesis was performed in a peptide synthesis reaction vessel (ChemGlass, CG-1860) with each reaction step carried out on a Burrel Scientific wrist action shaker ...
-
No products found
because this supplier's products are not listed.
Holly Holliday, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... Slides were blocked with Mouse on Mouse (MOM) blocking buffer (Vector Biolabs) for 1 hour ...
-
No products found
because this supplier's products are not listed.
Tomasz Zajkowski, et al.,
bioRxiv - Evolutionary Biology 2020
Quote:
Peptide solutions were adsorbed onto formvar/carbon-coated nickel grids (TED PELLA, CA, USA) in water ...
-
No products found
because this supplier's products are not listed.
Susan Klaeger, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Peptides were loaded onto an analytical column (25-30cm, 1.9um C18 (Dr. Maisch HPLC GmbH), packed in-house PicoFrit 75 μm inner diameter ...
-
No products found
because this supplier's products are not listed.
Katarzyna C. Pituch, et al.,
bioRxiv - Immunology 2020
Quote:
... Following blocking with PBS/2%FBS and washes with TBS-Tween 20 buffer (Boston Bioproducts, Ashland, MA), purified BiTE proteins or NSCs supernatants were incubated for 1h room temperature (RT ...
-
No products found
because this supplier's products are not listed.
Sung Hee Jo, et al.,
bioRxiv - Plant Biology 2019
Quote:
... 1 μM flg22 peptide (Cat No: FLG22-P-1; Alpha Diagnostics, Inc., San Antonio, TX, USA) was used as a positive control (Bethke et al. ...
-
The Poly DYKDDDDK (FLAG) Peptide lyophilized powder was synthesized by 23 amino acid residues...
Cat# B23111, SKU# B23111-4mg,
4mg, $299.00
Ask
Caillan Crowe-McAuliffe, et al.,
bioRxiv - Biochemistry 2020
Quote:
... RqcH-GS-FLAG3 was eluted by addition of 200 μL opening buffer containing 0.1 mg/mL poly-FLAG peptide (Biotool, Bimake) for 45 min on a turning wheel ...
-
No products found
because this supplier's products are not listed.
Ai Nguyen, et al.,
bioRxiv - Biophysics 2023
Quote:
... N-arm peptides were purchased from ABI Scientific (Sterling ...
-
No products found
because this supplier's products are not listed.
Katrin Schrenk-Siemens, et al.,
bioRxiv - Neuroscience 2019
Quote:
... before blocking solution (10% goat serum (PAN Biotech) in PBS ...
-
No products found
because this supplier's products are not listed.
Francisco Santos, et al.,
bioRxiv - Cell Biology 2024
Quote:
... and blocking with 5% goat serum (Abbkine Scientific) and 0.3% Triton X-100 in PBS1x for 1h at RT with agitation ...
-
No products found
because this supplier's products are not listed.
Deepti Mudaliar, et al.,
bioRxiv - Biochemistry 2024
Quote:
... CK2 Substrate (synthetic peptide RRRADDSDDDDD) was purchased from SignalChem Biotech Inc ...
-
No products found
because this supplier's products are not listed.
Natalia Pinello, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... incubated in blocking buffer with 1:500 rat anti-5hmC (Diagenode) overnight at 4°C and followed by incubation with 1:1000 anti-rat IgG HRP (ab6734 ...
-
No products found
because this supplier's products are not listed.
Natasha D. Durham, et al.,
bioRxiv - Microbiology 2019
Quote:
... 300 µl 1% BSA in PBS blocking buffer (Cat# B0101; Teknova, Hollister, CA) was added for 1 h either at room temperature (RT ...
-
The CY3 (Red) Collagen Hybridizing Peptide (CHP) is a synthetic peptide that can specifically...
Cat# 5276-60UG,
0.3 mg, USD $290.0
Ask
Amber L. Altrieth, et al.,
bioRxiv - Cell Biology 2023
Quote:
Collagen hybridizing peptide (CHP) conjugated to 5-carboxyfluorescein (5-FAM) (Advanced BioMatrix) was solubilized per manufacturer’s recommendations ...
-
No products found
because this supplier's products are not listed.
Andrea Messina, et al.,
bioRxiv - Neuroscience 2020
Quote:
... After being treated with a blocking solution (composed of Fetal Bovine Serum (Euroclone, Italy), Blocking Reagent (Roche ...
-
No products found
because this supplier's products are not listed.
Sudha Silwal Gautam, et al.,
bioRxiv - Bioengineering 2020
Quote:
... calcitonin gene-related peptide (CRGP, 1:800, guinea pig polyclonal; Progen Biotechnik GmbH), or vascular endothelial cell marker von Willebrand factor (vWF ...
-
No products found
because this supplier's products are not listed.
Hem Gurung, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... The peptide-buffer mixtures were dispensed and reformatted into 384 well plates (Labcyte) at a volume of 47.5 μl per well ...
-
No products found
because this supplier's products are not listed.
Tyson J. Ruetz, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Slides were treated with 50-70 µL blocking solution (5% normal donkey serum [NDS, ImmunoReagents, SP-072-V×10] ...
-
No products found
because this supplier's products are not listed.
Pavlo Gilchuk, et al.,
bioRxiv - Immunology 2020
Quote:
... mice were treated with 2 mg of an Ifnar1-blocking antibody (MAR1-5A3, Leinco Technologies) by i.p ...
-
No products found
because this supplier's products are not listed.
Andrew V. Grassetti, Rufus Hards, Scott A. Gerber,
bioRxiv - Cell Biology 2021
Quote:
... lyophilized peptides were dissolved in 50% acetonitrile (ACN; Honeywell) / 2M lactic acid (Lee Biosolutions), incubated with 1.25 mg TiO2 microspheres (GL Sciences ...
-
No products found
because this supplier's products are not listed.
Nir Salinas, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Peptide solution drops (100 nl) were dispensed by the Mosquito automated liquid dispensing robot (TTP Labtech, UK), onto crystallization screening plates ...
-
No products found
because this supplier's products are not listed.
Huan Wang, et al.,
bioRxiv - Neuroscience 2022
Quote:
The linear optical properties of the GRAB peptide sensors expressed in HEK293T cells were measured using a Safire 2 plate reader (Tecan). Cells were harvested and transferred to black-wall 384-well plates containing either saline alone or saline containing the corresponding peptides ...
-
No products found
because this supplier's products are not listed.
Richard M. Hooy, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Peptide fractions were pooled then incubated at a molar ratio of 1:1.1 (excess lipid) with MPB-PE (Avanti Polar Lipids) for 3- 12 hours at 25C with end-over-end mixing ...
-
No products found
because this supplier's products are not listed.
Fenghui Zhao, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The purified peptide 20–GLP-1R–Gs–Nb35 complex (3.5 μL) was applied to glow-discharged holey carbon grids (Quantifoil R1.2/1.3, 300 mesh), and subsequently vitrified using a Vitrobot Mark IV (ThermoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Rick G. Kim, et al.,
bioRxiv - Plant Biology 2024
Quote:
... Biotinylated peptides were searched using exogenous biotin (ExBio) on lysine as a variable modification ...
-
No products found
because this supplier's products are not listed.
László Imre, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Cyclodextrin/peptide complex formation was performed by mixing 30 μM peptide and 300 μM SBECD (Sulfobutylether-β-Cyclodextrin; CycloLab, Budapest, Hungary) diluted in colorless ...
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
Anne-Sophie Hafner, et al.,
bioRxiv - Neuroscience 2019
Quote:
... After 30 min in blocking buffer cells were incubated with mouse anti-puromycin (Kerafast, 1:2000) for 1 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Linda Balabanian, et al.,
bioRxiv - Biophysics 2021
Quote:
... Cells were then washed with Blocking Buffer: 2% (w/v) BSA (BioShop Canada Inc., Burlington, ON), 0.2% (w/v ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Peter Verstraelen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Permeabilization was done in blocking buffer (0.1% bovine serum albumin, 10% normal horse serum (Innovative Research IGHSSER) in PBS ...
-
No products found
because this supplier's products are not listed.
Chiara Aloise, et al.,
bioRxiv - Microbiology 2023
Quote:
... The cells were then incubated in blocking buffer containing mouse anti-dsRNA (1:1000; English & Scientific Consulting), goat anti-eIF3η (1:200 ...
-
No products found
because this supplier's products are not listed.
Ji-Hoon Lee, et al.,
bioRxiv - Bioengineering 2024
Quote:
... incubated with primary antibody against spike protein diluted 1:5,000 in blocking buffer (Elabscience, E-AB-V1006) overnight in a 37°C incubator with 5% CO2 injection ...
-
No products found
because this supplier's products are not listed.
Krista K. Alexander, et al.,
bioRxiv - Biochemistry 2023
Quote:
Peptides were diluted in water and were analyzed using a 1.00 mm QS cuvette (Starna Cells). A JASCO J-710 circular dichroism spectrometer and JASCO Spectra Manager software were used to analyze the results using the following parameters ...
-
No products found
because this supplier's products are not listed.
The Nhu Nguyen, et al.,
bioRxiv - Microbiology 2023
Quote:
Antibody responses against IAV-S nucleoprotein (NP) were measured by using a commercial blocking ELISA (IDEXX, Montpellier, France), following the manufacturer’s recommendation ...
-
No products found
because this supplier's products are not listed.
Lei Wang, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... anti-human CD25-PE-Cy7 (clone MA251) plus FVD-eFluor-780 (eBioscience) and human FcR blocking Reagent (StemCell Technologies). Cells were washed then fixed and permeabilized using the eBioscience FOXP3/Transcription Factor Staining Buffer Set ...
-
No products found
because this supplier's products are not listed.
Justin M. Westerfield, et al.,
bioRxiv - Biophysics 2021
Quote:
... peptides were added to a saturated solution of α-cyano-4-hydroxy-cinnamic acid (TCI America, Portland, OR) in 70% acetonitrile (Fisher Chemical ...
-
No products found
because this supplier's products are not listed.
Nikolas Nikolaou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... This was removed and coverslips were incubated with fresh blocking solution containing anti-GFP 1:1000 (Torrey Pines Biolabs-TP401) and anti-SNRNP70 1:200 (Sigma-AV40276 ...
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Jhansi L. Leslie, et al.,
bioRxiv - Microbiology 2019
Quote:
... each plate had a positive control consisting of toxin coated wells reacted with mouse TcdA monoclonal antibody TGC2 diluted 1:5,000 in blocking buffer (antibodies-online.com ABIN335169). The optical density at 410nm and 650nm was recorded on a VersaMax plate reader (Molecular Devices ...
-
No products found
because this supplier's products are not listed.
Marianne E Emmert, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... through detection of the 7-amino-4-methylcoumarin (AMC) labeled fluorogenic peptide substrates Z-LLE-AMC (Boston Biochem #S-230) and LLVY-AMC (Chemicon #APT280) ...
-
No products found
because this supplier's products are not listed.
Takafumi Kato, et al.,
bioRxiv - Pathology 2021
Quote:
... PRR4 cDNA without a signal peptide sequence (corresponding to amino acids 17 to 134) was cloned into the pM-secSUMOstar Vector (7121, LifeSensors). SUMOstar-PRR4 vectors were transfected into Expi293 cells (1 mg of DNA per liter of transfection ...
-
No products found
because this supplier's products are not listed.
Marco Tognetti, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... the sample’s peptide concentrations were determined using a UV/VIS Spectrometer at 280 nm/430 nm (SPECTROstar Nano, BMG Labtech) and centrifuged at 14,000 × g at 4 °C for 30 min.
-
No products found
because this supplier's products are not listed.
Wenwei Li, et al.,
bioRxiv - Microbiology 2021
Quote:
... Crystal screening of Fab-peptide complexes were performed using the vapor-diffusion hanging drop method using the sparse matrix crystallization screens ProPlex (Molecular Dimensions), Index (Hampton Research) ...
-
No products found
because this supplier's products are not listed.
Michela Carlet, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... using a 5’ primer carrying NsiI and a 3’ primer carrying P2A-NsiI and ligated into the NsiI digested pCDH-SFFV-GLuc-T2A-mCherry vector downstream of the T2A peptide (Figure S2a) (pCDH-vector, System Bioscience). For inducible knockdown of target genes ...
-
No products found
because this supplier's products are not listed.
Zuriñe Antón, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The DPC-bound peptide sample was prepared by dissolving lyophilized peptide in PBS supplemented with 7% D2O with 0.7% perdeuterated d38-DPC (Cambridge Isotope Laboratories) at a final concentration of ~ 2 mM ...
-
No products found
because this supplier's products are not listed.
Toshiharu Ichinose, et al.,
bioRxiv - Neuroscience 2024
Quote:
... The ribosome-bound mRNA was eluted with 50 µl of 100 µg/ml 3× FLAG peptide (GEN-3XFLAG- 25, Protein Ark) dissolved in the lysis buffer.