-
No products found
because this supplier's products are not listed.
Sherif Salah, et al.,
bioRxiv - Immunology 2022
Quote:
... and membrane protein peptide (by AMSBIO) were procured ...
-
No products found
because this supplier's products are not listed.
Eric Waltari, et al.,
bioRxiv - Immunology 2019
Quote:
... Blocking solution (sciBLOCK Protein D1M solution, Scienion) was added at 200 μL/well with a multichannel pipet and allowed to incubate without agitation for 1 hour ...
-
No products found
because this supplier's products are not listed.
Ly Porosk, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Peptide-based transfection reagent Reagent007 from Icosagen suitable for suspension cells ...
-
No products found
because this supplier's products are not listed.
Tommaso Montecchi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... SEB and SEE peptides (2μg/ml) (Toxin Technology) or 1% BSA for controls ...
-
No products found
because this supplier's products are not listed.
Rick G. Kim, et al.,
bioRxiv - Plant Biology 2024
Quote:
... Biotinylated peptides were searched using exogenous biotin (ExBio) on lysine as a variable modification ...
-
No products found
because this supplier's products are not listed.
László Imre, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Cyclodextrin/peptide complex formation was performed by mixing 30 μM peptide and 300 μM SBECD (Sulfobutylether-β-Cyclodextrin; CycloLab, Budapest, Hungary) diluted in colorless ...
-
No products found
because this supplier's products are not listed.
Matthew J. Foulkes, et al.,
bioRxiv - Immunology 2019
Quote:
... The c-Jun N-terminal kinase inhibitor SP600125 was obtained from StressMarq Biosciences (Victoria, Canada), and tanshinone IIA (TIIA ...
-
No products found
because this supplier's products are not listed.
Shiho Yasue, et al.,
bioRxiv - Cell Biology 2023
Quote:
... USA) or 30 ng/ml MAPK kinase (MEK) inhibitor (trametinib; ChemScene, Monmouth Junction, NJ, USA) was added to these cells for examination of drug inhibition.
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
Gregory A. Breuer, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Blocking was performed in TBS-T with 5% BSA (Gold Biotechnology) for 1h at room temperature ...
-
Atrial Natriuretic Peptide ( ANP ) ELISA / Assay Kit
Cat# K071-H1,
1.0 ea, USD $385.0
Ask
Soon Yew Tang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
Atrial natriuretic peptide (Arbor Assays, K026-H1, Ann Arbor, MI), total nitrate+nitrite (Cayman Chemical ...
-
No products found
because this supplier's products are not listed.
Samir M. Abdelmagid, et al.,
bioRxiv - Cell Biology 2020
Quote:
The MicroVue™ Helical Peptide EIA kit (Quidel, San Diego, CA) was used to measure the level of a helical peptide containing the residues 620-633 of the type I collagen α1 chain or more formally carboxy-terminal collagen crosslinks ...
-
No products found
because this supplier's products are not listed.
Francesco Caiazza, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... and peptides desalted with C18 Desalting Tips (Rainin, Oakland, CA, USA), lyophilized ...
-
No products found
because this supplier's products are not listed.
Natasha D. Durham, et al.,
bioRxiv - Microbiology 2019
Quote:
... 300 µl 1% BSA in PBS blocking buffer (Cat# B0101; Teknova, Hollister, CA) was added for 1 h either at room temperature (RT ...
-
No products found
because this supplier's products are not listed.
Joshua Johnson, et al.,
bioRxiv - Physiology 2020
Quote:
... Endogenous peroxidase blocking was performed by using 3% hydrogen peroxide (Labchem, Cat # LC154301). Sections were then washed in water ...
-
The CY3 (Red) Collagen Hybridizing Peptide (CHP) is a synthetic peptide that can specifically...
Cat# 5276-60UG,
0.3 mg, USD $290.0
Ask
Amber L. Altrieth, et al.,
bioRxiv - Cell Biology 2023
Quote:
Collagen hybridizing peptide (CHP) conjugated to 5-carboxyfluorescein (5-FAM) (Advanced BioMatrix) was solubilized per manufacturer’s recommendations ...
-
No products found
because this supplier's products are not listed.
Xiaoshan Shi, et al.,
bioRxiv - Biochemistry 2020
Quote:
... ADP-Glo kinase assays and liposome sedimentation assays were expressed in HEK293-GnTI suspension cells by using the polyethylenimine (Polysciences) transfection system ...
-
No products found
because this supplier's products are not listed.
Sudha Silwal Gautam, et al.,
bioRxiv - Bioengineering 2020
Quote:
... calcitonin gene-related peptide (CRGP, 1:800, guinea pig polyclonal; Progen Biotechnik GmbH), or vascular endothelial cell marker von Willebrand factor (vWF ...
-
No products found
because this supplier's products are not listed.
Hem Gurung, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... The peptide-buffer mixtures were dispensed and reformatted into 384 well plates (Labcyte) at a volume of 47.5 μl per well ...
-
No products found
because this supplier's products are not listed.
Daniel Pokorny, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Both wild-type and kinase-dead (D286A) Sgk3 were expressed in baculvirus-infected Sf9 insect cells grown in ESF 921 medium (Expression Systems) at 27°C ...
-
No products found
because this supplier's products are not listed.
Pavel A. Makhnovskii, et al.,
bioRxiv - Physiology 2023
Quote:
... with 1% beta-mercaptoethanol in a 1.5-ml tube using a polypropylene pestle and a drill and then incubated (55 °C, 10 min) with protein kinase K (Evrogen, Russia). Total RNA was extracted by a silica spin column (CleanRNA Standard ...
-
Kinase Domain of Pyruvate Kinase liver is a peptide from pig liver.
Cat# abx265529-1MG,
1 mg USD $246.5
Ask
Daniel C. Levine, et al.,
bioRxiv - Neuroscience 2024
Quote:
... hypothalamus from PER2-TgWT mice that were fasted for 16 hours or given ad libitum access to HFD for 1 week was excised at ZT16 and extracted with ∼5 volumes of strong RIPA buffer containing kinase and phosphatase inhibitors (Abbexa abx090624), sonicated in a water bath 3 x 30sec on high ...
-
No products found
because this supplier's products are not listed.
Ning Zhou, et al.,
bioRxiv - Plant Biology 2024
Quote:
... The kinase reaction was quenched by adding SDS-PAGE loading buffer and then the NFR1, NFR1Y429F, and NFR1T481A kinase activities were analyzed using the anti-pTyr (GeneScript, CAT.A01819) or anti-pSer/Thr (ECM Biosciences, CAT.PP2551) antibodies ...
-
No products found
because this supplier's products are not listed.
Tyson J. Ruetz, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Slides were treated with 50-70 µL blocking solution (5% normal donkey serum [NDS, ImmunoReagents, SP-072-V×10] ...
-
No products found
because this supplier's products are not listed.
Bijal A. Parikh, et al.,
bioRxiv - Immunology 2019
Quote:
... Fc receptor blocking was performed with 2.4G2 (anti-FcγRII/III) hybridoma (American Type Culture Collection) culture supernatants ...
-
No products found
because this supplier's products are not listed.
Pavlo Gilchuk, et al.,
bioRxiv - Immunology 2020
Quote:
... mice were treated with 2 mg of an Ifnar1-blocking antibody (MAR1-5A3, Leinco Technologies) by i.p ...
-
No products found
because this supplier's products are not listed.
Emilio Boada-Romero, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Experiments using anti-PS blocking antibody were performed in µ-Slide Angiogeneis chambers (IBIDI, 81506) and cell numbers were scaled down accordingly.
-
No products found
because this supplier's products are not listed.
Logan S. Richards, et al.,
bioRxiv - Biochemistry 2021
Quote:
... The peptide crystals were harvested from hanging drops using CryoLoops™ from Hampton Research with no additional cryoprotectant other than the MPD already present and flash-frozen in liquid nitrogen ...
-
No products found
because this supplier's products are not listed.
S. M. Nayeemul Bari, et al.,
bioRxiv - Microbiology 2021
Quote:
... single stranded DNA substrates were labeled on their 5’-ends by incubating with T4 polynucleotide kinase and γ-[32P]-ATP and purified over a G25 column (IBI Scientific). Radiolabeled substrates were combined with 7.5 µl of each protein fraction ...
-
No products found
because this supplier's products are not listed.
James H. Joly, et al.,
bioRxiv - Systems Biology 2019
Quote:
All cell lines were cultured in high-glucose DMEM (4.5 g/l glucose, 110mM pyruvate; Mediatech) supplemented with 10% (v/v) FBS (Omega Scientific) plus 1% (v/v ...
-
No products found
because this supplier's products are not listed.
Veronika Magdanz, et al.,
bioRxiv - Bioengineering 2019
Quote:
Cryo-preserved bovine semen was thawed as mentioned above and centrifuged in SP-TL (Caisson Lab, no pyruvate or albumine) at 300g for 5 minutes and resuspended in 250μL SP-TALP supplemented with 100μg*mL−1 heparin-fluorescein conjugate H7482 (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Anne-Sophie Hafner, et al.,
bioRxiv - Neuroscience 2019
Quote:
... After 30 min in blocking buffer cells were incubated with mouse anti-puromycin (Kerafast, 1:2000) for 1 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Linda Balabanian, et al.,
bioRxiv - Biophysics 2021
Quote:
... Cells were then washed with Blocking Buffer: 2% (w/v) BSA (BioShop Canada Inc., Burlington, ON), 0.2% (w/v ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Peter Verstraelen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Permeabilization was done in blocking buffer (0.1% bovine serum albumin, 10% normal horse serum (Innovative Research IGHSSER) in PBS ...
-
No products found
because this supplier's products are not listed.
Chiara Aloise, et al.,
bioRxiv - Microbiology 2023
Quote:
... The cells were then incubated in blocking buffer containing mouse anti-dsRNA (1:1000; English & Scientific Consulting), goat anti-eIF3η (1:200 ...
-
No products found
because this supplier's products are not listed.
Krista K. Alexander, et al.,
bioRxiv - Biochemistry 2023
Quote:
Peptides were diluted in water and were analyzed using a 1.00 mm QS cuvette (Starna Cells). A JASCO J-710 circular dichroism spectrometer and JASCO Spectra Manager software were used to analyze the results using the following parameters ...
-
No products found
because this supplier's products are not listed.
The Nhu Nguyen, et al.,
bioRxiv - Microbiology 2023
Quote:
Antibody responses against IAV-S nucleoprotein (NP) were measured by using a commercial blocking ELISA (IDEXX, Montpellier, France), following the manufacturer’s recommendation ...
-
No products found
because this supplier's products are not listed.
Nir Salinas, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Peptide solution drops (100 nl) were dispensed by the Mosquito automated liquid dispensing robot (TTP Labtech, UK), onto crystallization screening plates ...
-
No products found
because this supplier's products are not listed.
Justin M. Westerfield, et al.,
bioRxiv - Biophysics 2021
Quote:
... peptides were added to a saturated solution of α-cyano-4-hydroxy-cinnamic acid (TCI America, Portland, OR) in 70% acetonitrile (Fisher Chemical ...
-
No products found
because this supplier's products are not listed.
Nikolas Nikolaou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... This was removed and coverslips were incubated with fresh blocking solution containing anti-GFP 1:1000 (Torrey Pines Biolabs-TP401) and anti-SNRNP70 1:200 (Sigma-AV40276 ...
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Jhansi L. Leslie, et al.,
bioRxiv - Microbiology 2019
Quote:
... each plate had a positive control consisting of toxin coated wells reacted with mouse TcdA monoclonal antibody TGC2 diluted 1:5,000 in blocking buffer (antibodies-online.com ABIN335169). The optical density at 410nm and 650nm was recorded on a VersaMax plate reader (Molecular Devices ...
-
No products found
because this supplier's products are not listed.
Marianne E Emmert, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... through detection of the 7-amino-4-methylcoumarin (AMC) labeled fluorogenic peptide substrates Z-LLE-AMC (Boston Biochem #S-230) and LLVY-AMC (Chemicon #APT280) ...
-
No products found
because this supplier's products are not listed.
Takafumi Kato, et al.,
bioRxiv - Pathology 2021
Quote:
... PRR4 cDNA without a signal peptide sequence (corresponding to amino acids 17 to 134) was cloned into the pM-secSUMOstar Vector (7121, LifeSensors). SUMOstar-PRR4 vectors were transfected into Expi293 cells (1 mg of DNA per liter of transfection ...
-
No products found
because this supplier's products are not listed.
Wenwei Li, et al.,
bioRxiv - Microbiology 2021
Quote:
... Crystal screening of Fab-peptide complexes were performed using the vapor-diffusion hanging drop method using the sparse matrix crystallization screens ProPlex (Molecular Dimensions), Index (Hampton Research) ...
-
No products found
because this supplier's products are not listed.
Toshiharu Ichinose, et al.,
bioRxiv - Neuroscience 2024
Quote:
... The ribosome-bound mRNA was eluted with 50 µl of 100 µg/ml 3× FLAG peptide (GEN-3XFLAG- 25, Protein Ark) dissolved in the lysis buffer.
-
No products found
because this supplier's products are not listed.
Anuli C. Uzozie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
Dried samples were resuspended in 0.1% TFA in 80% acetonitrile and phosphorylated peptides were purified by immobilized metal affinity chromatography (IMAC) using Fe-NTA MagBeads (Cube Biotech, Monheim, Germany). Sample solution was added to beads washed with 0.1% TFA in 80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Fenghui Zhao, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The purified peptide 20–GLP-1R–Gs–Nb35 complex (3.5 μL) was applied to glow-discharged holey carbon grids (Quantifoil R1.2/1.3, 300 mesh), and subsequently vitrified using a Vitrobot Mark IV (ThermoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Akesh Sinha, et al.,
bioRxiv - Immunology 2024
Quote:
... peptide (YPYDVPDYAGAGC) or N-terminally biotinylated HA peptide (Bio-HA) (GL Biochem Ltd., Shanghai, China) or HER2 extracellular domain (ECD) (Acrobiosystems, Newark, DE, USA) was used as antigen in ELISAs ...