-
Attachment Factor™ is an extracellular matrix (ECM) product that promotes cell attachment to...
Cat# 4Z0-201,
10.0 mL, $72.0
Ask
Ariana Umana, et al.,
bioRxiv - Microbiology 2019
Quote:
... cell attachment factor (Cell Systems) and a thin lining of collagen (5mg/ml_ ...
-
No products found
because this supplier's products are not listed.
Felicia Reinitz, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... mouse recombinant epidermal growth factor (EGF; 20 ng/ml) and basic fibroblast growth factor (bFGF; 20 ng/ml) (Shenandoah Biotechnology).
-
No products found
because this supplier's products are not listed.
Stacia M. Nicholson, Francis A.X. Schanne,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... Fc receptors were blocked for 30 min with Protein A (MP Biomedicals, OH) in Stain Buffer (554656 ...
-
No products found
because this supplier's products are not listed.
Kyle T. Shuler, et al.,
bioRxiv - Physiology 2020
Quote:
... 5 ng/ml basic-fibroblast growth factor (Progen, Heidleberg, Germany), and equal parts DMEM and Ham’s F10 mix ...
-
No products found
because this supplier's products are not listed.
Subhasri Ghosh, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Casper-1 antibody (AdipoGen) and corresponding mouse IgG (CST ...
-
No products found
because this supplier's products are not listed.
Ruth Pye, et al.,
bioRxiv - Immunology 2020
Quote:
... and placed in clot activating tubes (MTS, Sarstedt) for subsequent serum separation ...
-
No products found
because this supplier's products are not listed.
Pablo Alcón, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... the reaction contained 75 nM of E1 ubiquitin activating enzyme (Boston Biochem), 0.8 µM E2 (UBE2T)18 ...
-
No products found
because this supplier's products are not listed.
Stéphane D. Girard, et al.,
bioRxiv - Neuroscience 2022
Quote:
... 1% platelet-poor plasma derived bovine serum (Alfa Aesar), 20 ng/mL human recombinant basic fibroblast growth factor (bFGF ...
-
No products found
because this supplier's products are not listed.
Boning Chen, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... ɑ-factor (GenWay) was added to the culture at a final concentration of 50 ng/mL ...
-
No products found
because this supplier's products are not listed.
Mohan Kumar Muthu Karuppan, et al.,
bioRxiv - Immunology 2019
Quote:
... Pregnant dams received anti-interferon receptor 1 (anti-IFNAR1) monoclonal antibody (MAR-5A3, Leinco Technologies, MO, USA) at 2mg/animal via intraperitoneal (ip ...
-
No products found
because this supplier's products are not listed.
Sachin Kumar, et al.,
bioRxiv - Bioengineering 2020
Quote:
... The morphology of the obtained platelets was verified under brightfield microscopy (IX-81, Olympus) with a 40X ...
-
No products found
because this supplier's products are not listed.
Maaike S. A. Jongen, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Platelet experiments involved the delivery of HFE-7500 fluoro-oil (3M™ Novec™) with 0.75% (v/v ...
-
No products found
because this supplier's products are not listed.
Kerrie L. Marie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Lot# CA36131)/ 1:400 KDEL Receptor 3 (L95) polyclonal (Bioworld Technology Cat# BS3124 ...
-
No products found
because this supplier's products are not listed.
Johanna G. Rodríguez, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Phase contrast images for platelet morphometry were recorded with an optical microscope (TiE, Nikon, Tokyo, Japan) on fixed platelets using a 100x/1.45 NA immersion oil objective for human and murine platelets ...
-
No products found
because this supplier's products are not listed.
Timothy F. Shay, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Membrane associated receptor candidates were transfected by polyethylenimine (PolySciences # 23966). Cells were seeded on Neuvitro Poly-D-lysine coated sterile German glass coverslips (Fisher Scientific #NC0343705 ...
-
No products found
because this supplier's products are not listed.
Pere Català, et al.,
bioRxiv - Cell Biology 2021
Quote:
... 10 ng/ml epidermal growth factor (Amsbio), and 100 IU/mL penicillin-streptomycin (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Eleanor M Denham, et al.,
bioRxiv - Immunology 2019
Quote:
Cells were analysed for receptor surface expression by flow cytometry using anti-Strep-tag II antibody Oyster 645 (IBA Lifesciences # 2-1555-050), or anti-Strep-tag II antibody (IBA Lifesciences # 2-1507-001 ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
O Bogen, et al.,
bioRxiv - Neuroscience 2024
Quote:
... psi ε receptor for activated C kinase (ψεRACK) (27) was purchased from Biomatik (Wilmington, DE, USA), and the proinflammatory cytokine prostaglandin-E2 (PGE2 ...
-
No products found
because this supplier's products are not listed.
Shreyas S Kuduvalli, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... and Vascular Endothelial Growth Factor (VEGF) (1:100 dilution, Elabscience, Wuhan, China) for 30 minutes at room temperature ...
-
No products found
because this supplier's products are not listed.
Thusitha K. Karunarathna, et al.,
bioRxiv - Microbiology 2023
Quote:
Binding of virus and sialic receptor analogous was measured using an Octet Red biolayer interferometer (Pall FortéBio) as previously described (37) ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Krishna K. Narayanan, et al.,
bioRxiv - Microbiology 2023
Quote:
... The eluted proteins were concentrated with a centrifugal device (MWCO 30 kDa for soluble EFNB2 proteins and 50 kDa for soluble Eph receptor proteins; Sartorius) before being separated on a Superdex 200 Increase 10/300 GL (Cytiva Life Sciences ...
-
No products found
because this supplier's products are not listed.
Ignasi Cos, Giovanni Pezzulo, Paul Cisek,
bioRxiv - Neuroscience 2021
Quote:
... and for each combination of the following three factors: initial choice right or left (ICR/ICL), perturbation direction (PR/PL) ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Mario K. Shammas, et al.,
bioRxiv - Cell Biology 2021
Quote:
... primary antibody followed by secondary antibodies (Nanogold, Nanoprobes, Yaphank, NY) for 1-2 hours ...
-
No products found
because this supplier's products are not listed.
Chongping Li, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and goat anti-mouse IgG secondary antibody (L3032, Signalway Antibody).
-
No products found
because this supplier's products are not listed.
Farès Ousalem, et al.,
bioRxiv - Microbiology 2023
Quote:
... an HRP-conjugated antibody (Anti-rabbit IgG, antibody [HRP] from COVALAB) diluted 20,000x in PBS was used ...
-
No products found
because this supplier's products are not listed.
Roy G. Muriu, Jessica M. Sage, Abdulbaki Agbas,
bioRxiv - Neuroscience 2019
Quote:
... MBL antibodies (MBL International, 15A Constitution way ...
-
No products found
because this supplier's products are not listed.
Carson D. Bickley, Arash Komeili,
bioRxiv - Cell Biology 2024
Quote:
... primary antibody anti-MamE polyclonal antibody (1:3,000 dilution, produced by ProSci Inc), secondary antibody F(ab’)2-goat anti-mouse IgG (H+L ...
-
No products found
because this supplier's products are not listed.
Yuebiao Feng, et al.,
bioRxiv - Microbiology 2021
Quote:
... Immunoblotting was performed using standard procedures using the antibodies rabbit anti‐Per1 antibody (1:5000) and mouse anti‐β‐Actin antibody (1:2000) (Abbkine, China). The rabbit polyclonal anti‐Per1 antibody was generated against recombinant Per1 protein (recPer1 ...
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Katharina Hutter, et al.,
bioRxiv - Immunology 2022
Quote:
... Bound antibodies were visualized with HRP-labeled secondary antibodies and the ECL system (Advansta) on a light-sensitive film (Amersham ...
-
No products found
because this supplier's products are not listed.
Martin Privat, et al.,
bioRxiv - Neuroscience 2024
Quote:
... the primary antibody used was a rabbit anti-GFP antibody (TP401, Torrey pines biolabs) diluted 1:1000 in blocking buffer for overnight incubation ...
-
No products found
because this supplier's products are not listed.
Emily M. Sontag, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Anti-Nsp1 antibody from EnCor Biotechnology was used to visualize nuclear pores and Anti-Nsr1 antibody from Abcam was used for staining the nucleolus.
-
No products found
because this supplier's products are not listed.
Florian Wiede, et al.,
bioRxiv - Immunology 2019
Quote:
Serum anti-nuclear antibodies were detected with the mouse anti-nuclear antibodies Ig’s (total IgA+G+M) ELISA Kit from Alpha Diagnostic International ...
-
No products found
because this supplier's products are not listed.
Marcel Jansen, et al.,
bioRxiv - Immunology 2019
Quote:
... Platelets were re-pelleted and resuspended in 1 mL SSP+ (Storage solution for platelets, Sanquin, Amsterdam, the Netherlands). Platelet count and platelet activation were determined by flow cytometry (FACS Calibur ...
-
No products found
because this supplier's products are not listed.
Renée M. van der Sluis, et al.,
bioRxiv - Immunology 2021
Quote:
... antibodies blocking the type I IFN receptor (mouse anti-human IFNAR2 antibody, clone MMHAR-2, PBL Assay Science Cat#21385-1) or isotype control (Ultra-LEAF Purified mouse IgG2a ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Celine Everaert, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... five aliquots of 220 µl platelet-rich plasma (ePRP) were snap-frozen in 1.5 ml LoBind tubes (Eppendorf Protein LoBind microcentrifuge tubes Z666548 - DNA/RNA ...
-
No products found
because this supplier's products are not listed.
Anastasiia Stratiievska, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Intracellular calcium levels of a platelet population were recorded using a SpectraMax M5 (Molecular Devices, San Jose, CA) plate reader with 96 well plate adapter ...
-
This product is a 39.2 kDa Human PTAFR membrane protein expressed in Baculovirus/Insect...
Cat# MPC0342K,
1.0 case, Inquiry
Ask
Andrew D. Hoffmann, et al.,
bioRxiv - Immunology 2022
Quote:
... Results were normalized to the CR3022 antibody with known affinity to the receptor binding domain of SARS-CoV2 (Creative Biolabs, MRO-1214LC)(29 ...
-
No products found
because this supplier's products are not listed.
Dennis J. Doorduijn, et al.,
bioRxiv - Microbiology 2021
Quote:
... Cobra venom factor (CVF) was obtained from Quidel. Preassembled C5b6 ...
-
No products found
because this supplier's products are not listed.
Nobuyuki Oguri, et al.,
bioRxiv - Pathology 2023
Quote:
Human factor α-XIIa (Enzyme Research Laboratories Ltd) activity was measured at an enzyme concentration of 0.17 U/mL in 150 mM NaCl and 50 mM Tris-HCl (pH 7.4 ...
-
No products found
because this supplier's products are not listed.
Gabriella Fioravanti, et al.,
bioRxiv - Bioengineering 2020
Quote:
... 50 ng/mL nerve growth factor (Envigo NGF 2.5S), or 5nM ...
-
No products found
because this supplier's products are not listed.
Jessica Ciesla, et al.,
bioRxiv - Molecular Biology 2024
Quote:
Human tumor necrosis factor alpha (TNFα, GoldBio #1130-01-100), Interferon alpha (IFNα ...
-
No products found
because this supplier's products are not listed.
Joshua D’Rozario, et al.,
bioRxiv - Immunology 2021
Quote:
Diphtheria toxin receptor (DTR) FAP+ DM2 mice received 25ng/g diphtheria toxin (List Biological Laboratories) i.p ...
-
No products found
because this supplier's products are not listed.
NV DiBenedetto, et al.,
bioRxiv - Microbiology 2023
Quote:
... diluted at 4ng/ml in PBS was used for the capture antibodies and the T4G1 monoclonal antibodies previously coupled to biotin were used as detection antibodies (BBI solution, 1:10000 dilution) with streptavidin HRP (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Boris Bonaventure, et al.,
bioRxiv - Microbiology 2021
Quote:
... or J2 anti-dsRNA antibody (SCICONS), or anti-SARS-CoV-2 Nucleoprotein (N ...
-
No products found
because this supplier's products are not listed.
Oiti Kar, et al.,
bioRxiv - Microbiology 2023
Quote:
... Monoclonal antibodies against Stx2A (Hycult Biotech) and homemade OmpA antiserum36 were used to detect Stx2A and OmpA ...
-
No products found
because this supplier's products are not listed.
Juan Pablo Arroyo, et al.,
bioRxiv - Physiology 2022
Quote:
Antibody was developed with assistance from Phosphosolutions Inc ...