-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Justin M. Westerfield, et al.,
bioRxiv - Biophysics 2021
Quote:
... peptides were added to a saturated solution of α-cyano-4-hydroxy-cinnamic acid (TCI America, Portland, OR) in 70% acetonitrile (Fisher Chemical ...
-
No products found
because this supplier's products are not listed.
Nikolas Nikolaou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... This was removed and coverslips were incubated with fresh blocking solution containing anti-GFP 1:1000 (Torrey Pines Biolabs-TP401) and anti-SNRNP70 1:200 (Sigma-AV40276 ...
-
No products found
because this supplier's products are not listed.
Michela Carlet, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... using a 5’ primer carrying NsiI and a 3’ primer carrying P2A-NsiI and ligated into the NsiI digested pCDH-SFFV-GLuc-T2A-mCherry vector downstream of the T2A peptide (Figure S2a) (pCDH-vector, System Bioscience). For inducible knockdown of target genes ...
-
No products found
because this supplier's products are not listed.
Toshiharu Ichinose, et al.,
bioRxiv - Neuroscience 2024
Quote:
... The ribosome-bound mRNA was eluted with 50 µl of 100 µg/ml 3× FLAG peptide (GEN-3XFLAG- 25, Protein Ark) dissolved in the lysis buffer.
-
No products found
because this supplier's products are not listed.
Fenghui Zhao, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The purified peptide 20–GLP-1R–Gs–Nb35 complex (3.5 μL) was applied to glow-discharged holey carbon grids (Quantifoil R1.2/1.3, 300 mesh), and subsequently vitrified using a Vitrobot Mark IV (ThermoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Gregory A. Breuer, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Blocking was performed in TBS-T with 5% BSA (Gold Biotechnology) for 1h at room temperature ...
-
No products found
because this supplier's products are not listed.
Emily Tubbs, et al.,
bioRxiv - Bioengineering 2024
Quote:
... The cells were permeabilized by a blocking buffer containing FBS (ScienCell Research Laboratories ...
-
Atrial Natriuretic Peptide ( ANP ) ELISA / Assay Kit
Cat# K071-H1,
1.0 ea, USD $385.0
Ask
Soon Yew Tang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
Atrial natriuretic peptide (Arbor Assays, K026-H1, Ann Arbor, MI), total nitrate+nitrite (Cayman Chemical ...
-
No products found
because this supplier's products are not listed.
Breanna Q. Shen, et al.,
bioRxiv - Neuroscience 2022
Quote:
Slides were incubated with blocking buffer (10% Normal Goat Serum, Atlanta Biologicals, Cat #S13150h ...
-
No products found
because this supplier's products are not listed.
Samir M. Abdelmagid, et al.,
bioRxiv - Cell Biology 2020
Quote:
The MicroVue™ Helical Peptide EIA kit (Quidel, San Diego, CA) was used to measure the level of a helical peptide containing the residues 620-633 of the type I collagen α1 chain or more formally carboxy-terminal collagen crosslinks ...
-
No products found
because this supplier's products are not listed.
Belinda Liu, et al.,
bioRxiv - Biochemistry 2019
Quote:
... or the insulin receptor signal peptide were synthesized by Eton Biosciences. Similarly ...
-
No products found
because this supplier's products are not listed.
Francesco Caiazza, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... and peptides desalted with C18 Desalting Tips (Rainin, Oakland, CA, USA), lyophilized ...
-
No products found
because this supplier's products are not listed.
Joshua Johnson, et al.,
bioRxiv - Physiology 2020
Quote:
... Endogenous peroxidase blocking was performed by using 3% hydrogen peroxide (Labchem, Cat # LC154301). Sections were then washed in water ...
-
No products found
because this supplier's products are not listed.
Diogo F.T. Veiga, et al.,
bioRxiv - Genomics 2020
Quote:
... non-unique-PacBio+Uniprot (peptides mapped to both PacBio and Uniprot proteins), and multigene (peptides mapped to multiple genes).
-
The peptide is used to block Anti-Parkin Antibody (#CPA4767) reactivity.
Cat# CBP4767,
1 mg USD $100.0, 5 mg USD $300.0
Ask
Rafał Zdrzałek, et al.,
bioRxiv - Plant Biology 2024
Quote:
... membranes were incubated with appropriate antibodies diluted in blocking buffer (α-FLAG: Cohesion Biosciences, at 1:3000 dilution ...
-
No products found
because this supplier's products are not listed.
Bijal A. Parikh, et al.,
bioRxiv - Immunology 2019
Quote:
... Fc receptor blocking was performed with 2.4G2 (anti-FcγRII/III) hybridoma (American Type Culture Collection) culture supernatants ...
-
No products found
because this supplier's products are not listed.
Marcin Pęziński, et al.,
bioRxiv - Cell Biology 2019
Quote:
... and 100 nM Actistain conjugated to AlexaFluor 555 (in blocking buffer; catalog no. PHDH1, Cytoskeleton), followed by three washes with PBS ...
-
No products found
because this supplier's products are not listed.
Emilio Boada-Romero, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Experiments using anti-PS blocking antibody were performed in µ-Slide Angiogeneis chambers (IBIDI, 81506) and cell numbers were scaled down accordingly.
-
No products found
because this supplier's products are not listed.
Mark J. Wall, et al.,
bioRxiv - Physiology 2020
Quote:
... Peptides for interfering with G protein signalling were obtained from Hello Bio (Bristol, UK) and were based on published sequences16 ...
-
No products found
because this supplier's products are not listed.
Logan S. Richards, et al.,
bioRxiv - Biochemistry 2021
Quote:
... The peptide crystals were harvested from hanging drops using CryoLoops™ from Hampton Research with no additional cryoprotectant other than the MPD already present and flash-frozen in liquid nitrogen ...
-
No products found
Matthias Felten, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Proteolysis into peptides was accomplished using 0.5% (w/w) Trypsin (sequencing grade; Worthington Biochemical) (37 °C ...
-
No products found
because this supplier's products are not listed.
Lydia Zhang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Peptides were diluted in water and acidified with 1.2M formic acid (Thomas Scientific, A11750) in preparation for mass spectrometry analysis.
-
No products found
because this supplier's products are not listed.
Asuka Hirooka, et al.,
bioRxiv - Evolutionary Biology 2020
Quote:
... a 10-amino acid-peptide called NMC or GRP-10 (AssayPro, St. Charles, MO, USA) for 48 hours at 4°C ...
-
No products found
because this supplier's products are not listed.
Jonathan Pansieri, et al.,
bioRxiv - Biophysics 2020
Quote:
... Aβ42 fibrils were prepared by incubating 100 μM Aβ42 peptide in phosphate buffer saline (PBS, Medicago) at pH 7.4 and 42°C ...
-
No products found
because this supplier's products are not listed.
Jesse Goyette, et al.,
bioRxiv - Immunology 2020
Quote:
... For the avitag-CD3ζ ITAM3 peptide DNA construct BirA-transformed BL21 (DE3) Escherichia coli (BPS Bioscience) were used ...
-
No products found
because this supplier's products are not listed.
Shounak Banerjee, et al.,
bioRxiv - Biophysics 2022
Quote:
... Diisopropylcarbodiimide (DIC) and Oxyma Pure (Eythylcyanohyroxyiminoacetate) were purchased in peptide synthesis grade from AK Scientific (USA). General reagents such as N,N-diisopropyl ethyl amine (DIPEA) ...
-
No products found
because this supplier's products are not listed.
Gema M. Olivarria, et al.,
bioRxiv - Microbiology 2021
Quote:
... Cells were incubated overnight at 4°C in blocking solution with primary antibodies anti-MAP2 (EnCor Biotech. Cat:NC0388389) and anti-SARS-CoV-2 nucleocapsid (Sino Bio ...
-
No products found
because this supplier's products are not listed.
Coral K. Wille, et al.,
bioRxiv - Genetics 2023
Quote:
... 1x PBS) and probed for 1 hour in blocking buffer containing α-NANOG (1:100; Cosmo Bio USA, REC-RCAB001P or 1:1000 ...
-
Recombinant protein fragment of Human SMIM1
Cat# MOB-0423ZL,
Inquiry
Ask
Haizhang Chen, et al.,
bioRxiv - Immunology 2020
Quote:
... Recombinant CD20 was obtained as a peptide (aa141-188) containing the binding region of rituximab (Creative Biolabs). FcγR-specific mAbs were obtained from Stem Cell technologies (CD16 ...
-
No products found
because this supplier's products are not listed.
Maria Körner, et al.,
bioRxiv - Cell Biology 2023
Quote:
Pulldown assays using immobilized GST fusion proteins or biotinylated peptide (Biotin- CQGLYFHINQTLREAHFHSLQHRG-COOH; PANATecs GmbH, Tübingen, Germany) were essentially performed as described (Böhm et al ...
-
No products found
because this supplier's products are not listed.
James B. Bower, Scott A. Robson, Joshua J. Ziarek,
bioRxiv - Biophysics 2024
Quote:
... The dissolved peptide was added to a 1 mL Float-A-Lyzer G2 Dialysis Device from Repligen with a 0.5-1 kDa cutoff ...
-
No products found
because this supplier's products are not listed.
Andrew T. Phillips, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Wells were then washed 4 times with TBST and then incubated in 1x Blocking Buffer in PBS with a 1:10,000 dilutions of either β1- (Assay Biotechnology; San Francisco ...
-
No products found
because this supplier's products are not listed.
Sylvain Perriot, et al.,
bioRxiv - Immunology 2024
Quote:
... transfected Jurkat cells and co-culture with HLA-unenhanced neurons or in presence of a blocking anti-HLA ABC antibody (W6/32, AffinityImmuno). Luminescence was measured with a Multimode Microplate Reader (BioTek Synergy) ...
-
No products found
because this supplier's products are not listed.
Chanchan Xiao, et al.,
bioRxiv - Immunology 2021
Quote:
... 0.5×106 CD8+ T cells isolated from health donors were co-cultured with 0.5 × 106 peptide-loaded T2A2 cells stained with 5 µmol/L CFSE (TargetMol), and stimulated with 1 µg/mL anti-human CD28 antibodies (BioLegend ...
-
No products found
because this supplier's products are not listed.
Frank Hidalgo, et al.,
bioRxiv - Biophysics 2022
Quote:
... Peptides were desalted for 4 minutes on a trap column (1 mM ID x 2 cm, IDEX C-128) manually packed with POROS R2 reversed-phase resin (Thermo Scientific 1112906) ...
-
No products found
because this supplier's products are not listed.
Natalie Schindler, et al.,
bioRxiv - Genetics 2022
Quote:
... cells were synchronized in G1 phase by addition of 4 µg/mL α-factor (Zymo research, mating hormone peptide) for 2 h ...
-
No products found
because this supplier's products are not listed.
Zahra Hosseinzadeh, et al.,
bioRxiv - Bioengineering 2023
Quote:
... The insulin of each sample was measured with the C-Peptide & Insulin AccuBind VAST ELISA Kits (Monobind Inc., USA). Three independent experiments were performed for each group ...
-
No products found
because this supplier's products are not listed.
Simona Giunta, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Incubations with primary antibodies were conducted in blocking buffer for 1 h at room temperature using the following antibodies: ACA (1:500; 15-235-0001, Antibodies Incorporated), ATR (1:1000 ...
-
No products found
because this supplier's products are not listed.
Barr Tivon, et al.,
bioRxiv - Biochemistry 2021
Quote:
... 4 µl of 20 mM alkyne-peptide in DMSO were mixed with 10 µl of 5 mM BDP-TMR-azide (Lumiprobe). To the mixture was added 50 µl water ...
-
No products found
because this supplier's products are not listed.
Sandeep Adem, et al.,
bioRxiv - Bioengineering 2020
Quote:
Biotin-PEG36-Thr-Phe-Ser-Tyr-Nle-Arg-Trp-Pro-PEG12-Cys (known as peptide) was synthesized by CPC Scientific and Biotin-PEG-SH (known as linker) was purchased from NANOCS. Peptide (2 µM ...
-
No products found
because this supplier's products are not listed.
Nikola Cousin, et al.,
bioRxiv - Immunology 2021
Quote:
OT-1 effector T cells were generated by ex vivo culture of total Ly5.1+ OT-1 splenocytes in T cell medium supplemented with 1 ng/ml SIINFEKL peptide and 100 U/ml recombinant mouse IL-2 (ImmunoTools) for 72 h ...
-
No products found
because this supplier's products are not listed.
Alexander T. Hilditch, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
Solid-phase peptide synthesis (SPPS) reagents were purchased from Cambridge Reagents with the exception of N,N’-diisopropylcarbodiimide (DIC) purchased from Carbosynth. Rink amide MBHA resin and Fmoc-protected amino were purchased from Merck ...
-
No products found
because this supplier's products are not listed.
Fei Yang, et al.,
bioRxiv - Pathology 2023
Quote:
... overnight at 4℃ in a blocking solution and then with colloidal gold-conjugated anti-rabbit IgG (1.4-nm diameter; 1:200; #2003, Nanoprobes, Yaphank, NY, USA) in a blocking solution for 2 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Eric Blanc, et al.,
bioRxiv - Genomics 2019
Quote:
For immunisation 8-12-week old ABabDII mice were injected subcutaneously with 100 µg of mutant short peptide (9-10mers, JPT) supplemented with 50 µg CpG 1826 (TIB Molbiol), emulsified in incomplete Freund’s adjuvant (Sigma) ...
-
No products found
because this supplier's products are not listed.
Erin M. Euliano, et al.,
bioRxiv - Bioengineering 2024
Quote:
... Near-infrared fluorescent peptides were made by coupling 2 equivalents N-hydroxysuccinimide (NHS) ester-functionalized ATTO 647N (ATTO-TEC, Siegen, Germany) to the N-terminus with 4 equivalents of DIEA overnight protected from light ...
-
No products found
because this supplier's products are not listed.
Douek-Maba Orit, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... followed by an overnight incubation at 4°C in blocking solution with anti phospho-histone 3 (PhH3) antibody or anti-caspase 3 (Cas3) antibody (both 1:300; Lifespan Bioscience. Washington US). Next ...
-
No products found
because this supplier's products are not listed.
Cesar Augusto Roque Borda, et al.,
bioRxiv - Microbiology 2021
Quote:
... and 64 mmol L-1 (PEP2) of Ctx(Ile21)-Ha peptide in 2% (w/w) sodium alginate homogenized using an UltraTurrax-T18 (IKA-Labortechnik, Germany) at 25,000 rpm min-1 and sonicated with an ultrasound probe (Hilscher ...
-
No products found
because this supplier's products are not listed.
Anuli C. Uzozie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
Dried samples were resuspended in 0.1% TFA in 80% acetonitrile and phosphorylated peptides were purified by immobilized metal affinity chromatography (IMAC) using Fe-NTA MagBeads (Cube Biotech, Monheim, Germany). Sample solution was added to beads washed with 0.1% TFA in 80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Akesh Sinha, et al.,
bioRxiv - Immunology 2024
Quote:
... peptide (YPYDVPDYAGAGC) or N-terminally biotinylated HA peptide (Bio-HA) (GL Biochem Ltd., Shanghai, China) or HER2 extracellular domain (ECD) (Acrobiosystems, Newark, DE, USA) was used as antigen in ELISAs ...