-
No products found
because this supplier's products are not listed.
Nathan J. Dwarshuis, et al.,
bioRxiv - Bioengineering 2019
Quote:
The anti-CD19-CD8-CD137-CD3z chimeric antigen receptor with the EF1α promotor [28] was synthesized (Aldevron) and subcloned into a FUGW lentiviral transfer plasmid (Emory Viral Vector Core) ...
-
No products found
because this supplier's products are not listed.
Florian Bleffert, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Phospholipid substrates purchased from Avanti Polar Lipids (Alabaster, USA) were prepared for PLA activity assays (25 μL enzyme + 25 μL substrate ...
-
No products found
because this supplier's products are not listed.
Chirag H Patel, et al.,
bioRxiv - Immunology 2023
Quote:
... containing chimeric antigen receptor (CAR) was made using Platinum-E (Plat-E) Retroviral Packaging Cell Line (Cell Biolabs). Fresh virus with human IL-2 was spin fected onto retronectin coated plates according to protocol (33156338) ...
-
Cat# AB-N14,
100 micrograms,USD $325.0
Ask
Lidia I. Madrid, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Infusion of murine-p75 neurotrophin receptor (p75NTR)-Saporin (hereafter abbreviated as p75-Sap; 0.4 µg/µl; Advanced Targeting System) or control rabbit-IgG-Saporin (IgG-Sap ...
-
No products found
because this supplier's products are not listed.
Rachael Kuintzle, et al.,
bioRxiv - Systems Biology 2023
Quote:
... All of the Notch receptor piggyBac constructs were derived from the vector PB-CMV-MCS-EF1-Puro (System Biosciences), with changes made to the promoter (CMV changed to PGK or CAG ...
-
Platelet-Derived Growth Factor Receptor Substrate 1; PDGF Receptor Substrate is a peptide.
Cat# abx265686-1MG,
1 mg USD $246.5
Ask
Michaela Frolikova, et al.,
bioRxiv - Cell Biology 2023
Quote:
... diluted 1:50 in 1% BSA in PBS and rabbit polyclonal anti-Folate receptor 4 (Juno) (abx102438, Abbexa, UK) diluted 1:50 in 1% BSA in PBS followed by 1 hr ...
-
No products found
because this supplier's products are not listed.
James P Bridges, et al.,
bioRxiv - Cell Biology 2021
Quote:
... on top of a thin substrate of 70% Cultrex (Trevigen)/30% rat tail collagen (Advanced Biomatrix ...
-
No products found
because this supplier's products are not listed.
Joseph de Rutte, et al.,
bioRxiv - Bioengineering 2021
Quote:
... antibody atezolizumab and the anti-interleukin 8 receptor beta (IL-8Rb) antibody 10H2 were cloned into the gwiz mammalian expression vector (Genlantis) and used for transient transfection of HEK 293T cells loaded into nanovials ...
-
No products found
because this supplier's products are not listed.
Krishna K. Narayanan, et al.,
bioRxiv - Microbiology 2023
Quote:
... The eluted proteins were concentrated with a centrifugal device (MWCO 30 kDa for soluble EFNB2 proteins and 50 kDa for soluble Eph receptor proteins; Sartorius) before being separated on a Superdex 200 Increase 10/300 GL (Cytiva Life Sciences ...
-
No products found
because this supplier's products are not listed.
Greg T. Chism, Wiley Faron, Anna Dornhaus,
bioRxiv - Animal Behavior and Cognition 2022
Quote:
... and then weighed each substrate using a digital scale (Ohaus, USA) to the nearest 0.00001g.
-
No products found
because this supplier's products are not listed.
Sefora Conti, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... cells were mechanically dissociated from gel substrates using cell scrapers (Biologix) and lysed with RIPA (Radio-Immunoprecipitation Assay ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Renée M. van der Sluis, et al.,
bioRxiv - Immunology 2021
Quote:
... antibodies blocking the type I IFN receptor (mouse anti-human IFNAR2 antibody, clone MMHAR-2, PBL Assay Science Cat#21385-1) or isotype control (Ultra-LEAF Purified mouse IgG2a ...
-
No products found
because this supplier's products are not listed.
Madalee G. Wulf, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... 500 nM substrate RNA (5’-[m7Gppp]GUAGAACUUCGUCGAGUACGCUCAA[FAM]-3, Bio-Synthesis, Inc.), and 60 nM yDcpS at 37 °C for 60 minutes ...
-
No products found
because this supplier's products are not listed.
Michihito Sasaki, et al.,
bioRxiv - Microbiology 2021
Quote:
... and visualized with a Histofine diaminobenzidine substrate kit (Nichirei Biosciences, Tokyo, Japan).
-
No products found
because this supplier's products are not listed.
Sarah M Pearsall, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... and subcutaneously implanted into the flank of 8-16-week-old non-obese diabetic (NOD) severe combined immunodeficient (SCID) interleukin-2 receptor γ– deficient (NSG) mice (Charles River). CDX models were generated from patients’ CTCs enriched from blood samples at pre-chemotherapy baseline and/or at post-treatment disease progression time-points (designated P ...
-
No products found
because this supplier's products are not listed.
Parinya Samakkarnthai, et al.,
bioRxiv - Physiology 2023
Quote:
... Then 10 μM or 20 μM of fluorogenic substrate C12FDG (Setareh Biotech, USA) were added to IMR90 cells or MEFs ...
-
No products found
because this supplier's products are not listed.
Susanne N. Walker, et al.,
bioRxiv - Immunology 2020
Quote:
... Followed by capture of SARS-CoV-2 receptor binding domain which was biotinylated using the lightning-link type-A biotinylation kit(Expedeon/Abcam, 370-0005) for 180s at 10ul/min ...
-
No products found
because this supplier's products are not listed.
Angela M. Bosco-Lauth, et al.,
bioRxiv - Microbiology 2020
Quote:
... Positive control antibodies to the receptor-binding domain (RBD) and full-length spike protein were human MAb CR3022 antibody (Absolute Antibody, Oxford UK) and human IgG whole molecule (Jackson Immuno Research ...
-
No products found
because this supplier's products are not listed.
Jinghan Tan, Susanne Neupert, Jean-Paul Paluzzi,
bioRxiv - Zoology 2024
Quote:
... These amplified products were then purified as above and restriction enzyme digested CCHa1R and CCHa2R sequences were ligated into pcDNA3.1+ and pBudCE4.1 mammalian expression vectors followed by bacterial transformation and plasmid DNA purification to obtain a large quantity of receptor constructs using ZymoPURE II Plasmid Midiprep Kit (Zymo Research, Tustin, CA, USA) following the manufacturer recommendation ...
-
No products found
because this supplier's products are not listed.
Yongchan Lee, et al.,
bioRxiv - Biochemistry 2021
Quote:
... transport of 100 μM radioisotope substrates (L-[14C]ornithine (2 Ci/mol; Moravek Biochemicals), L-[3H]tyrosine (10 Ci/mol ...
-
No products found
because this supplier's products are not listed.
MT Heemskerk, et al.,
bioRxiv - Immunology 2021
Quote:
... diluted in PBS for 10 min at RT and Fc-receptors were subsequently blocked using 5% human serum (HS; Sanquin Blood bank, Amsterdam, The Netherlands) for 45 min at RT ...
-
No products found
because this supplier's products are not listed.
J. De Smet, et al.,
bioRxiv - Microbiology 2021
Quote:
... both larval and substrate samples were also homogenized using a stomacher (BagMixer 400CC, Interscience, France) for 1 minute.
-
No products found
because this supplier's products are not listed.
Yasuko Tobari, et al.,
bioRxiv - Animal Behavior and Cognition 2021
Quote:
... the sections were stained with 0.02% 3,3-diaminobenzidine substrate solution (Dojindo Molecular Technologies, Kumamoto, Japan) for 5 min ...
-
No products found
because this supplier's products are not listed.
Zahra Allahyari, et al.,
bioRxiv - Bioengineering 2019
Quote:
The PLL-g-PEG patterned substrates were examined using an MFP-3D AFM (Oxford Instruments). TR800PSA cantilevers (Oxford Instruments ...
-
No products found
because this supplier's products are not listed.
Jian Cui, et al.,
bioRxiv - Immunology 2023
Quote:
... 12.5 μL of the FXa substrate RGR-XaChrom (4 mM, Enzyme Research Laboratories#100-03) was added and the mixture was incubated at 37 °C for 15 minutes ...
-
No products found
because this supplier's products are not listed.
Margarita Kublanovsky, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... the GFP-fused substrate proteins were immunoprecipitated from the cell extract using GFP-Trap A beads (Chromotek) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Brian T. Analikwu, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... we prepared mica substrates by punching 3.2 mm mica discs from mica sheets (V4 grade, SPI supplies) and gluing them to magnetic stainless steel discs with 2-component epoxy glue ...
-
No products found
because this supplier's products are not listed.
Chuyun Chen, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Mice were then anesthetized after receiving the substrates in a chamber with 2.5% isoflurane (RWD Life Science Co.) and placed on the imaging platform while being maintained on 2% isoflurane via a nose cone ...
-
No products found
because this supplier's products are not listed.
Dikki Pedenla Bomzan, et al.,
bioRxiv - Plant Biology 2023
Quote:
... 2005) with the corresponding NBD(NitroBenzoxadiazol)- modified fluorescent prenyl substrates (respectively NBD-FPP or NBD-GGPP, Jena Biosciences). GSTs equipped with a farnesylatable CAIM (GST-CAIM ...
-
No products found
because this supplier's products are not listed.
Alexia Caillier, et al.,
bioRxiv - Cell Biology 2023
Quote:
... For passivated substrates glass was coated with either 1 mg/mL PLL-PEG (JenKem Technology, PLL20K-G35-PEG2K) or 1mg/mL PMOXA (SuSoS ...
-
No products found
because this supplier's products are not listed.
Marc Ramos-Llorens, et al.,
bioRxiv - Biochemistry 2024
Quote:
... All FA substrates (>98–99% pure) used for the functional characterisation assays were obtained from Nu-Chek Prep, Inc ...
-
No products found
because this supplier's products are not listed.
Washington Logroño, et al.,
bioRxiv - Bioengineering 2020
Quote:
... The bottles were fed with gaseous substrate as described above and incubated at 37.4°C in an orbital shaking incubator (IKA KS 4000 ic control ...
-
No products found
because this supplier's products are not listed.
Anil H. Kadam, et al.,
bioRxiv - Bioengineering 2022
Quote:
... ABTS substrate (KPL, Maryland WA), TRIS-buffered saline (TBS, 10X) pH=7.4 for western blot (Alfa Aesar, Tewksbury, MA) and 10% neutral buffered formalin (Leica biosystems ...
-
No products found
because this supplier's products are not listed.
Meenakshi Basu Shrivastava, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Visualization of immunoreactive proteins was performed using horseradish peroxidase-linked secondary antibodies and Covalight enhanced chemiluminescent substrate (Covalab, Bron, France) or Immobilon® Western (Millipore) ...
-
No products found
because this supplier's products are not listed.
Neilloy Roy, Emily Turner-Brannen, Adrian R West,
bioRxiv - Bioengineering 2019
Quote:
... The polyacrylamide was activated for ECM protein coating by covering the substrates with 500 μL of 0.5 mg/mL sulfo-SANPAH (Proteochem c1111) in HEPES buffer and exposing to 365 nm UV light for 6 minutes (Spectrolinker XL-1000 ...
-
No products found
because this supplier's products are not listed.
Daniel J. Steiner, et al.,
bioRxiv - Immunology 2020
Quote:
Arrays were printed on amine-reactive silicon oxide substrates (Adarza BioSystems, Inc.) using a Scienion SX piezoelectric microarrayer (Scienion, A.G.) with spot volumes of approximately 300 pL ...
-
No products found
because this supplier's products are not listed.
S. John Liu, et al.,
bioRxiv - Cancer Biology 2022
Quote:
Human Schwann cells (HSC) were cultured in complete Schwann Cell Medium on Poly-L-Lysine coated substrates (ScienCell Research Laboratories). HEI-193 schwannoma cells were cultured in Dulbecco’s Modified Eagle Medium supplemented with 10% fetal bovine serum (FBS) ...
-
No products found
because this supplier's products are not listed.
Azam Aslemarz, et al.,
bioRxiv - Cell Biology 2023
Quote:
Stock solution for soft polyacrylamide substrates of 5 kPa rigidity containing far-red fluorescent nanobeads (Bangs laboratory, FC02F, 0.19 μm) were prepared by mixing acrylamide 40% (A4058 ...
-
No products found
because this supplier's products are not listed.
Milena S. Espindola, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Plates were then washed and the wells were developed by adding 100 µl of TMB peroxidase substrate solution (Fitzgerald Industries International) until sufficient color is observed ...
-
No products found
because this supplier's products are not listed.
Samuel Schmidt, et al.,
bioRxiv - Cell Biology 2020
Quote:
... incubated 24h at 4 °C) were used as substrates and prepared in Willco dishes (35 mm, Willco Wells B.V., HBSt-3522) as described46 ...
-
No products found
because this supplier's products are not listed.
Dorothee Kottmeier, et al.,
bioRxiv - Microbiology 2021
Quote:
... Each reaction (20 μL) consisted of 1 μL of cDNA substrate and 19 μL of a SensiFAST No-ROX Kit Master Mix (Bioline, UK). Following primer optimisation ...
-
No products found
because this supplier's products are not listed.
Anupama Kante, Jeroen Roelofs, Eric J. Deeds,
bioRxiv - Biochemistry 2023
Quote:
... gels were rinsed in water for 10 mins and then transferred into activity assay buffer containing HNE (20mM HEPES, 300mM, 1mM EDTA, pH 7.0) and 50mM of the fluorogenic substrate Z-VLR AMC (Adipogen Life sciences). The gel was incubated in the activity assay buffer for 20 mins at 370C with intermittent shaking ...
-
No products found
because this supplier's products are not listed.
Haylie R. Helms, et al.,
bioRxiv - Bioengineering 2024
Quote:
GFP+ HUVEC and RFP+ MDA-MB-231 were printed onto a collagen type 1 substrate and in cultured in a 1:1 ratio of HUVEC media (VascuLife VEGF, Lifeline Cell Technology) and MDA-MB-231 media (DMEM + 10% FBS + 1% penicillin-streptomycin) ...
-
No products found
because this supplier's products are not listed.
Yilie Liao, et al.,
bioRxiv - Biochemistry 2021
Quote:
Primary hepatocytes were incubated with different substrates or inhibitors for 16-24 hours at following concentrations: 10mM glucose (Amresco, Cat#0188-500G); 4mM glutamine (Gibco ...
-
No products found
because this supplier's products are not listed.
Haixia Zhu, et al.,
bioRxiv - Molecular Biology 2023
Quote:
MST experiments to measure the binding affinities between TadAs and the 19-nt DNA substrate were performed on a Monolith NT.115 system (NanoTemper Technologies, Germany) using the nano BLUE detector ...
-
No products found
because this supplier's products are not listed.
Olivia Bulka, et al.,
bioRxiv - Microbiology 2023
Quote:
... was added to the reaction buffer and the respective substrates were suppled to a final concentration of 0.5 mM using saturated water stocks and glass syringes (Hamilton Company, Reno, NV). Once the substate was added ...
-
No products found
because this supplier's products are not listed.
Marie Ruoyun Tan, et al.,
bioRxiv - Physiology 2023
Quote:
The cortisol levels from the three biological substrates (plasma, fin and mucus) were quantified using an enzyme-linked immunosorbent assay (ELISA) kit (Fish Cortisol ELISA, CUSABIO, Houston, TX, USA). The ELISA is based on the competitive inhibition enzyme immunoassay principle ...
-
No products found
because this supplier's products are not listed.
Sándor Váczi, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... The examined enzyme reaction started after pipetting the tracer substrate 1-14C-AA (3.7 kBq, 0.172 nM in each sample; American Radiolabeled Chemicals, Inc., St Louis, MO 63146 USA) into the incubation mixture ...
-
Peptide to PDGF Receptor Substrate
Cat# CCP2750,
1 mg USD $200.0, 5 mg USD $500.0, 10 mg USD $750.0
No citation found on bioRxiv