-
Coronavirus Antigen
Cat# REC31835-100,
100µg USD $461.0
Ask
Alexander A. Lehmann, et al.,
bioRxiv - Immunology 2020
Quote:
... truncated Spike protein (S1 domain) (The Native Antigen Company, Oxford, UK) or receptor binding domain (RBD ...
-
No products found
because this supplier's products are not listed.
Idil Ulengin-Talkish, et al.,
bioRxiv - Biochemistry 2021
Quote:
... The phosphospecific antibody against Serine 485 site in FAM126A was manufactured by 21st Century Biochemicals as follows ...
-
Recombinant COVID-19 Spike protein receptor binding domain (RBD) was fused to His-tag at...
Cat# Spike-190V,
50ug , USD $368
Ask
Sunil Yeruva, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Recombinant protein of human DSG2 tagged with IgG Fc domain (Fc) (Creative Biomart; #DSG2-1601H) and N-CAD-Fc (Sino Biological ...
-
Cat# HA268-050,
USD $225.0/50.0µg
Ask
Tri Komala Sari, et al.,
bioRxiv - Microbiology 2019
Quote:
... and H1817 (domain VI) were from Virusys. Anti-gB monoclonal antibodies DL16 (oligomer-specific ...
-
No products found
because this supplier's products are not listed.
Tatsushi Yokoyama, et al.,
bioRxiv - Neuroscience 2023
Quote:
... the cpRFP domain was synthesized (FragmentGENE, GENEWIZ), and RSET ...
-
No products found
because this supplier's products are not listed.
Edward I. Patterson, et al.,
bioRxiv - Microbiology 2020
Quote:
... and a domain linker ((G4S)4) between the variable heavy (VH) and variable light (VL) domains (Integrative DNA Technologies) (Figure 1B) ...
-
PASK Antibody is a Rabbit Polyclonal against PASK.
Cat# abx333731-1MG,
1 mg USD $1885.0
Ask
Daniel C. Levine, et al.,
bioRxiv - Neuroscience 2024
Quote:
... hypothalamus from PER2-TgWT mice that were fasted for 16 hours or given ad libitum access to HFD for 1 week was excised at ZT16 and extracted with ∼5 volumes of strong RIPA buffer containing kinase and phosphatase inhibitors (Abbexa abx090624), sonicated in a water bath 3 x 30sec on high ...
-
No products found
because this supplier's products are not listed.
Mike R. Schlabach, et al.,
bioRxiv - Immunology 2023
Quote:
... Ribonucleoprotein (RNP) master mixes containing Cas9 protein (Aldevron, Cat#9212) and u728 sgRNA or a7mm OLF sgRNA were added to the cell suspension and transferred to processing assembly (MaxCyte) ...
-
No products found
because this supplier's products are not listed.
Xu Han, et al.,
bioRxiv - Physiology 2023
Quote:
... (Chrono-log Corporation, PA)
-
No products found
because this supplier's products are not listed.
Jiyun Chen, et al.,
bioRxiv - Biophysics 2023
Quote:
... CjLas1-Grc3 complex and CjLas1 truncated protein (HEPN domain) were first obtained using the sitting drop vapor diffusion method using high-throughput crystallization screening kits (Hampton Research, Molecular Dimensions and QIAGEN). Crystals were then grown in a mixed solution containing 1 μl complex solution and 1 μl of reservoir solution using the hanging drop vapor diffusion method at 16°C ...
-
No products found
because this supplier's products are not listed.
Elad Horwitz, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... A custom library of kinase inhibitors was purchased from TargetMol. Cell counts for long term viability assays were carried using CellDrop (Denovix ...
-
No products found
because this supplier's products are not listed.
Marina Chan, et al.,
bioRxiv - Systems Biology 2021
Quote:
... Recombinant purified N-terminal domain (NTD) of the SARS-CoV-2 was obtained from Leinco Technologies Inc (Cat #S853 ...
-
No products found
because this supplier's products are not listed.
Subhrajit Banerjee, et al.,
bioRxiv - Cell Biology 2024
Quote:
... 50 ml of yeast cultures of indicated genotypes were grown in SC medium and were labeled with 100µCi of [3H]-Serine (American Radiolabeled Chemicals, ART0246) at 18°C for 1hr ...
-
No products found
because this supplier's products are not listed.
Pei Xin Lim, Mahdia Zaman, Maria Jasin,
bioRxiv - Molecular Biology 2023
Quote:
... cell pellets were resuspended in wash buffer containing CD71− FITC antibody (Meridian Life Science) and RNaseA (Thermo Fisher) ...
-
No products found
because this supplier's products are not listed.
Lauriane Cornuault, et al.,
bioRxiv - Physiology 2022
Quote:
... PLN phosphorylation at Serine 16 and Threonin 17 was evaluated by SDS PAGE using rabbit anti-phospho-PLN Ser16 (Badrilla, Cat# A010-12), rabbit anti-phospho-PLN Thr17 (Badrilla ...
-
No products found
because this supplier's products are not listed.
Clay D. Jackson-Litteken, et al.,
bioRxiv - Microbiology 2022
Quote:
... Purified protein was then used by Antibody Research Corporation (St. Peters, MO) to generate polyclonal rabbit antibody.
-
No products found
because this supplier's products are not listed.
Kim Reid, et al.,
bioRxiv - Cell Biology 2022
Quote:
... The solution was centrifuged 16,000g for 10 minutes at 4°C and the supernatant containing the mitochondrial or cell lysate proteins quantified (Bio-Rad DC Protein Assay, BMG Labtech POLARstar Omega plate reader).
-
No products found
because this supplier's products are not listed.
Marie S. Prevost, et al.,
bioRxiv - Neuroscience 2023
Quote:
... The supernatant containing solubilized proteins was bound overnight at 4°C on a gravity flow Rho1D4 resin (Cube Biotech) equilibrated with buffer A supplemented with 0.05% DDM ...
-
No products found
because this supplier's products are not listed.
Laura Medina-Puche, et al.,
bioRxiv - Plant Biology 2019
Quote:
... GFP-fused proteins were detected using mouse monoclonal anti-GFP antibody (1:5,000; Abiocode).
-
No products found
because this supplier's products are not listed.
Dorothea Höpfner, et al.,
bioRxiv - Biochemistry 2020
Quote:
... samples containing 100 ng recombinant protein were run over a 5 μm Jupiter C4 300Å LC column (Phenomenex, Torrance, California) using the 1260 Infinity LC system (Agilent Technologies ...
-
No products found
because this supplier's products are not listed.
Gherardo Baudo, et al.,
bioRxiv - Neuroscience 2023
Quote:
... we used a rotating rod apparatus (Ugo Basile Harvard Apparatus, PA, US). Mice were placed on the rod and the speed was gradually increased from 4 to 40 rpm ...
-
No products found
because this supplier's products are not listed.
Rory N. Pruitt, et al.,
bioRxiv - Plant Biology 2020
Quote:
... Protein blotting was performed using antibodies against GFP (Torrey Pines Biolabs, Secaucus, New Jersey, US), HA (Sigma ...
-
No products found
because this supplier's products are not listed.
Shafali Gupta, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Rabbit antibodies against the following proteins were used: GAPDH (Trevigen 2275-PC-100; 1:5000), p114 RhoGEF (Abcam ab96520 ...
-
No products found
because this supplier's products are not listed.
Shuqi Li, et al.,
bioRxiv - Microbiology 2021
Quote:
... or study sample were added to 100 µL of 50/50 (acetonitrile/methanol) protein precipitation solvent containing the stable labeled internal standards RIF-d8 (Toronto Research Chemicals; R508003), AZM-d5 (Toronto Research Chemicals ...
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
Yuan Ren, et al.,
bioRxiv - Cell Biology 2023
Quote:
... an aliquot of the crosslinked protein-DNA mixture was mixed with 5 μL 2.1 μm diameter anti-digoxigenin antibody coated polystyrene beads (Spherotech) and incubated at room temperature for 15 min ...
-
No products found
because this supplier's products are not listed.
Ronald McGregor, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and incubated for 72 hours at 4°C in a PBST solution containing rabbit anti-Hcrt-1 primary antibody (1:10000, H-003-30, Lot # 01108, Phoenix Pharmaceuticals Inc.) or rabbit anti-MCH (1:20000 ...
-
No products found
because this supplier's products are not listed.
Jing Shao, et al.,
bioRxiv - Physiology 2022
Quote:
... Protein concentration was determined using BCA Protein Assay Kit (TIANGEN) and diluted in loading dye (β-mercaptoethanol 5% ...
-
No products found
because this supplier's products are not listed.
Daria A. Egorova, et al.,
bioRxiv - Microbiology 2022
Quote:
... Total protein quantity was measured with QuDye Protein kit (Lumiprobe) on Qubit fluorometer (ThermoScientific).
-
No products found
because this supplier's products are not listed.
Shuo Li, et al.,
bioRxiv - Neuroscience 2020
Quote:
... solution containing Ni-NTA-gold (Nanoprobes) was added to each well containing two sapphire disks so that the final concentration of 5 nM is achieved ...
-
No products found
because this supplier's products are not listed.
Katherine A. Sharp, et al.,
bioRxiv - Cell Biology 2021
Quote:
... containing 1% Pen/Strep (Caisson Labs), 10% FBS (Gibco) ...
-
No products found
because this supplier's products are not listed.
Nora Kostow, Matthew D. Welch,
bioRxiv - Cell Biology 2022
Quote:
... containing 5% milk (Genesee, 20-241), then incubated with 1:5000 anti-VgrG in 5% milk in TBS-T overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Marissa Lindman, et al.,
bioRxiv - Immunology 2023
Quote:
... containing prewarmed Neuronal Medium (ScienCell, #1521) following manufacturer recommendations and used for experiments 6 DIV.
-
No products found
because this supplier's products are not listed.
Alexis Bouin, et al.,
bioRxiv - Microbiology 2022
Quote:
... diluted 1:500 in blocking solution for detection of viral protein VP1 or anti dsRNA antibody (SCICONS, anti-dsRNA mAb J2, 10010500) diluted 1:1000 in blocking solution overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Dasmanthie De Silva, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... containing Stellaris RNA FISH probes (Biosearch Technologies) at a final concentration of 125 nM (Supplementary File 6 ...
-
No products found
because this supplier's products are not listed.
Brunno R. Levone, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Proteins were quantified using a validated BCA (Bicinchoninic Protein Assay Kit, EuroClone) protocol ...
-
No products found
because this supplier's products are not listed.
Eric E. Irons, et al.,
bioRxiv - Immunology 2019
Quote:
... twice dehydrated in xylene-containing HistoClear (National Diagnostics), then rehydrated in successive ethanol solutions ...
-
No products found
because this supplier's products are not listed.
Benjamin Gotte, et al.,
bioRxiv - Microbiology 2019
Quote:
... The sections were thoroughly washed in the same buffer and bound antibodies were detected with protein A coated with 10 nm gold (BBI solution, Analytic standard, Sweden) at a final dilution of 1:100 ...
-
No products found
because this supplier's products are not listed.
Michael J. Pereira, et al.,
bioRxiv - Microbiology 2021
Quote:
... or C1s proteins (Complement Technologies), or BSA (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Logan R. Hurst, et al.,
bioRxiv - Cell Biology 2020
Quote:
... fusion reactions (60 μL) containing 20 μg of purified vacuoles were incubated in fusion reaction buffer containing 150 nM of Cal-520 (AAT Bioquest). Anti-Sec17 IgG was added at a concentration of 80 μg/mL to inhibit calcium efflux ...
-
No products found
because this supplier's products are not listed.
Roland Thuenauer, et al.,
bioRxiv - Microbiology 2022
Quote:
... was incubated with a solution containing streptavidin-coated polystyrene beads containing the dye Flash red with 1 µm diameter (Bangs Laboratories). To ensure homogenous coverage with LecB-biotin ...
-
No products found
because this supplier's products are not listed.
Eva Balint, Ildiko Unk,
bioRxiv - Biochemistry 2020
Quote:
... and the TT-dimer containing oligonucleotide was from Trilink Biotechnologies ...
-
No products found
because this supplier's products are not listed.
Andrea P. Cabrera, et al.,
bioRxiv - Pathology 2021
Quote:
... containing protease and phosphatase inhibitors (Boston BioProducts, Ashland, MA), followed by centrifugation and loading of the equal amounts of protein into a 10% SDS-polyacrylamide gel ...
-
No products found
because this supplier's products are not listed.
Seren Hamsici, Gokhan Gunay, Handan Acar,
bioRxiv - Bioengineering 2022
Quote:
... Fmoc protected amino acids (Gyros Protein Technologies) were removed through treatment with 20% piperidine/DMF solution for 45 min (three times for 15 min ...
-
No products found
because this supplier's products are not listed.
Yann Aquino, et al.,
bioRxiv - Genomics 2022
Quote:
... Recombinant IFN-χ protein (PBL Assay Science) was used as a calibrator ...
-
No products found
because this supplier's products are not listed.
Robert J. Cassell, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
Sprague Dawley rat plasma containing K2-ethylenediaminetetraacetic acid (Innovative Research, MI, USA) was transferred into 300 μL aliquots and stored at −20 °C until use ...
-
No products found
because this supplier's products are not listed.
Michael G. Spelios, et al.,
bioRxiv - Immunology 2021
Quote:
... His-tagged peptide containing the SARS-CoV-2-specific furin motif (EpiGentek), and His-tagged SARS-CoV-2 S1 RBD protein lacking the S1/S2 boundary furin site (EpiGentek ...
-
No products found
because this supplier's products are not listed.
Ah-Lai Law, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Protein A bead precleared lysates were incubated with primary antibody or non-immune control IgG followed by 1% BSA blocked protein A beads (Pierce) or protein A/G beads (Alpha Diagnostics). For GFP-trap or Myc-trap pulldowns ...
-
No products found
because this supplier's products are not listed.
Mariano Martinez, et al.,
bioRxiv - Microbiology 2023
Quote:
Blots were incubated with antibodies (1/3000 dilution) purified on G-protein (Proteogenix, France), followed by horseradish peroxidase-conjugated (HRP ...
-
No products found
because this supplier's products are not listed.
Eunice Paisana, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... UBE2C protein levels were assessed by immunohistochemical (IHC) staining with UBE2C antibody (Boston Biochem, Cat# A650) or Ki-67 (D2H10 ...