-
No products found
because this supplier's products are not listed.
Rafaela Muniz de Queiroz, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... anti-integrin alpha-3 (cat#A02902) and anti-integrin alpha-2 (cat#A01933-2) were purchased from Boster Biological Technology ...
-
No products found
because this supplier's products are not listed.
Alexander B. Coley, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Human embryonic kidney (HEK293) cell line was obtained from GenLantis (San Diego, CA) and cultured in MEM (Mediatech ...
-
No products found
because this supplier's products are not listed.
Aleksei Kuznetsov, et al.,
bioRxiv - Biochemistry 2020
Quote:
Human recombinant ACE2-His protein (Icosagen OÜ, Estonia, cat# P-302-100) and SARS-CoV-2 Spike protein S1 (Icosagen OÜ ...
-
No products found
because this supplier's products are not listed.
Edward G. Meloni, et al.,
bioRxiv - Neuroscience 2023
Quote:
... with laboratory bedding (Alpha Chip; Northeastern Products Co.) and one square (5 x 5 cm) of nesting material (Nestlet; Ancare). All mice were maintained on 12/12 h light dark cycles (lights on at 700 h ...
-
No products found
because this supplier's products are not listed.
Hoa Quynh Do, et al.,
bioRxiv - Biochemistry 2021
Quote:
... and lipid-protein nanodiscs (MSP1D1-His-POPC, MSP1D1-His-DMPG, MSP1D1-His-DMPC, Cube Biotech) were used to solubilize in-situ synthesized PCFT ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Bjoern Traenkle, et al.,
bioRxiv - Immunology 2021
Quote:
... an alpaca (Vicugna pacos) was immunized with the purified extracellular domains of human CD4 (aa26-390) recombinantly produced in HEK293 cells (antibodies-online GmbH, Germany). After initial priming with 1 mg ...
-
No products found
because this supplier's products are not listed.
Luis Alfonso Yañez Guerra, Meet Zandawala,
bioRxiv - Evolutionary Biology 2023
Quote:
... HEK293-G5a (Angio-proteomie CAT no. cAP0200GFP-AEQ-Cyto) cells were cultured in 96 well-plates containing 100μl of DMEM (Thermo ...
-
No products found
because this supplier's products are not listed.
Kerrie L. Marie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Lot# CA36131)/ 1:400 KDEL Receptor 3 (L95) polyclonal (Bioworld Technology Cat# BS3124 ...
-
No products found
because this supplier's products are not listed.
Michael G. Spelios, et al.,
bioRxiv - Immunology 2021
Quote:
... purified His-tagged ACE2 (EpiGentek) was added at a concentration of 100 ng/well (prepared with PBS ...
-
No products found
because this supplier's products are not listed.
Madeleine F. Jennewein, et al.,
bioRxiv - Immunology 2021
Quote:
To investigate Fc receptor binding recombinant Fc receptors with an AviTag were biotinylated using a Bir500 kit (Avidity, Aurora, CO, USA) according to manufacturer’s instructions and purified using a Zeba Spin Desalting Column ...
-
This Type IV Collagen is isolated from human placenta and is purified using a multi-step...
Cat# 5022-5MG,
5 mg, USD $310.0
Ask
Lauren J. Lahey, et al.,
bioRxiv - Biochemistry 2020
Quote:
HEK293 cell lines were seeded in PurCol-coated (Advanced BioMatrix) 6-well plates at 300,000 total cells in 2 mL media one day before transfection ...
-
No products found
because this supplier's products are not listed.
Tingting Zhang, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Neuronal morphology was analyzed and reconstructed with Imaris ×64 9.7.1 software (Oxford Instruments). Imaris was used to analyze parameters regarding apical dendrites ...
-
No products found
because this supplier's products are not listed.
Andrew K.J. Boyce, et al.,
bioRxiv - Neuroscience 2023
Quote:
Neuronal activity was recorded at 512 Hz using an AC amplifier (A-M systems) and collected using DATAQ acquisition software ...
-
No products found
because this supplier's products are not listed.
Siran Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
No products found
because this supplier's products are not listed.
Marisol Sampedro-Castañeda, et al.,
bioRxiv - Neuroscience 2023
Quote:
... rabbit anti Cav2.3 N-terminus 1:250 (Covalab, custom 1, HEK293 & brain), rabbit anti pS15 Cav2.3 1:500 (Covalab ...
-
No products found
because this supplier's products are not listed.
Atsuko Uchida, Juan Peng, Anthony Brown,
bioRxiv - Cell Biology 2022
Quote:
... the neuronal cell culture medium was replaced with Hibernate-A medium (BrainBits, low fluorescence formulation) supplemented with 2% (v/v ...
-
No products found
because this supplier's products are not listed.
Measho H. Abreha, et al.,
bioRxiv - Neuroscience 2020
Quote:
Paraffin embedded human postmortem brain sections (5 μm) were deparaffinized in Histo-clear (National Diagnostics) and rehydrated in ethanol ...
-
No products found
because this supplier's products are not listed.
Qi Yan Ang, et al.,
bioRxiv - Microbiology 2021
Quote:
Human stool samples were homogenized with bead beating for 5 min (Mini-Beadbeater-96, BioSpec) using beads of mixed size and material (Lysing Matrix E 2mL Tube ...
-
No products found
because this supplier's products are not listed.
Pierluigi Di Chiaro, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... anti-Collagen IV alpha 2 (3 μg/ml, Atlas Antibodies, #HPA069337), anti-LAMA5 (5 μg/ml ...
-
No products found
because this supplier's products are not listed.
Thomas Kampourakis, et al.,
bioRxiv - Biochemistry 2023
Quote:
The catalytic subunit was cloned into a pET15b vector and validated via sequencing by Bio Basic/(USA) ...
-
No products found
because this supplier's products are not listed.
Amrita Sule, et al.,
bioRxiv - Cancer Biology 2021
Quote:
YFP-ATM was immunoprecipitated from stably transfected HEK293 cells by GFP-TRAP (Chromotek). The immunoprecipitates were suspended in kinase assay buffer containing 2 μCi of [γ-32P] ATP ...
-
No products found
because this supplier's products are not listed.
MEENAKSHI TETORYA, et al.,
bioRxiv - Plant Biology 2023
Quote:
His-tagged GMA4CG_WT and GMA4CG_V6 was obtained from Biomatik Inc ...
-
No products found
because this supplier's products are not listed.
Saejeong Park, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... HEK293 cells were washed with PBS and lysed in NP-40 lysis buffer (Boston Bioproducts) including protease and phosphatase inhibitor (Roche) ...
-
No products found
because this supplier's products are not listed.
Martina Oravcová, et al.,
bioRxiv - Cell Biology 2022
Quote:
Endogenous level of DNA damage in HEK293 cells was evaluated using the CometAssay kit (Trevigen) according the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Maria Steene Eriksen, et al.,
bioRxiv - Biochemistry 2019
Quote:
Fluorescently tagged Arc and StrepII tagged Arc were coexpressed in HEK293 cells and purified using Strep-Tactin Sepharose (IBA Lifesciences). Formation of complexes between the indicated Arc constructs was analyzed by immunoblotting following SDS electrophoresis ...
-
No products found
because this supplier's products are not listed.
Peng Zhang, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Keigi Fujiwara (University of Texas MD Anderson Cancer Center, Houston, TX) and IP3R1-null HEK293 cells (Kerafast, Inc., Boston, MA) (Alzayady ...
-
No products found
because this supplier's products are not listed.
Indira Wu, Hee Shin Kim, Tuval Ben-Yehezkel,
bioRxiv - Genomics 2019
Quote:
... while human liver total RNA and human blood total RNA were purchased from Zyagen. LoopSeq Transcriptome kit was obtained from Loop Genomics ...
-
No products found
because this supplier's products are not listed.
Anne Rehkamp, et al.,
bioRxiv - Biochemistry 2020
Quote:
LC separation of peptides originating from HEK293 cell membranes was performed via selfpacked C18 columns (PicoFrits, 75 μm x 50 cm, 15 μm tip, New Objective, self-packed with ReproSil-Pur 120 C18-AQ ...
-
No products found
because this supplier's products are not listed.
Mei Lin, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and the PH domains from phospholipase C-δ1 (PLCδ-PH) and general receptor for phosphoinositides (GRP1-PH) were constructed by cloning PCR-amplified cDNA into pET-SUMO vector (LifeSensors), in frame with the N-terminal 6His-SUMO tag ...
-
No products found
because this supplier's products are not listed.
Daniel Schindler, et al.,
bioRxiv - Synthetic Biology 2022
Quote:
... The DNA Hi-C libraries were sheared into 300 bp using a Covaris S220 apparatus (Covaris) and the biotin-labeled fragments were selectively captured by Dynabeads Myone Streptavidin C1 ...
-
No products found
because this supplier's products are not listed.
Damian Dudka, R. Brian Akins, Michael A. Lampson,
bioRxiv - Cell Biology 2023
Quote:
... Centromeres were labeled with CREST (human anti-human Anti-Centromere Antibody, 1:200, Immunovision, HCT-0100) and an Alexa Fluor 594–conjugated goat anti-human secondary antibody (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Anna K. Hundsdoerfer, et al.,
bioRxiv - Genomics 2023
Quote:
... euphorbiae (from one head each; the same individuals used for the PacBio genome and Hi-C sequencing) and neural tissue from the internal reference standard Acheta domesticus (female ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Alexandra Zak, et al.,
bioRxiv - Biophysics 2019
Quote:
Silica beads (5 × 106; 5 μm diameter; Bangs Laboratories) were washed in distilled water (5,000 rpm ...
-
No products found
because this supplier's products are not listed.
Katharina Hoette, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Isolation of organoids from the embedding matrix (human hepatic organoids: Matrigel, Corning; human pancreatic organoids: Cultrex BME2, Amsbio) for fixation and whole-mount staining was performed with slight modifications of protocols published by Broutier et al ...
-
No products found
because this supplier's products are not listed.
Yue Wang, et al.,
bioRxiv - Biophysics 2021
Quote:
... 3 μl of purified ghrelin-bound complex at 13 mg/ml and GHRP-6-bound ghrelin receptor complex at 8 mg/ml were applied individually onto a glow-discharged holey carbon grid (Quantifoil, Au300 R1.2/1.3) in a Vitrobot chamber (FEI Vitrobot Mark IV) ...
-
No products found
because this supplier's products are not listed.
Donggi Paik, et al.,
bioRxiv - Immunology 2021
Quote:
... 5% FBS (Genesee), 1 g/L cellobiose (Sigma) ...
-
No products found
because this supplier's products are not listed.
Yukiko Yamaguchi, et al.,
bioRxiv - Immunology 2022
Quote:
... containing 100 U/mL recombinant human IL-2 (rhIL-2, Novartis Oncology) and 0.5 ng/mL recombinant human IL-15 (rhIL-15, CellGenix). For CAR lentiviral transduction ...
-
No products found
because this supplier's products are not listed.
V. Praveen Chakravarthi, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... 30 IU of human chorionic gonadotropin (hCG; BioVendor) was injected intraperitoneally ...
-
No products found
because this supplier's products are not listed.
Nicholas B. Karabin, et al.,
bioRxiv - Bioengineering 2020
Quote:
... Pooled human plasma was acquired from Zen-Bio Inc ...
-
No products found
because this supplier's products are not listed.
Maurizio Chioccioli, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... using human Col1a1 and Acta2 primers from ABI for the specified gene and species.
-
No products found
because this supplier's products are not listed.
Lars Gruber, et al.,
bioRxiv - Biochemistry 2023
Quote:
Monoculture and biculture spheroids of CCD-1137Sk human fibroblasts and HT-29 human colon cancer cells (both LGC Standards, Wesel, Germany) were prepared ...
-
No products found
because this supplier's products are not listed.
Eric R Szelenyi, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and 5 cm lane width (Stoelting). For testing ...
-
No products found
because this supplier's products are not listed.
Lucia Pedicini, et al.,
bioRxiv - Cell Biology 2020
Quote:
... IDA data were searched against human database in ProteinPilot 4.5 (AB-SCIEX, Canada).
-
No products found
because this supplier's products are not listed.
Desingu Ayyappa Raja, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... at 5% CO2 (Eppendorf® New Brunswick Galaxy170S). Media was changed every day and cells were passaged upon reaching 80% confluence ...
-
No products found
because this supplier's products are not listed.
Myung Chung, et al.,
bioRxiv - Neuroscience 2024
Quote:
... HEK293-EGFP (GenTarget, Cat. No. #SC001), and NIH-3T3 (originally obtained from Riken Bioresource Research Center and gifted from Dr ...
-
No products found
because this supplier's products are not listed.
Vincent Soubannier, et al.,
bioRxiv - Neuroscience 2019
Quote:
... human iPSC-derived astrocytes were incubated with tumour necrosis factor alpha (TNFa) (30 ng/ml; Cell Sciences; Newburyport, MA; Cat. No. CRT100B), interleukin alpha (IL-1a ...
-
No products found
because this supplier's products are not listed.
Zane Kliesmete, et al.,
bioRxiv - Evolutionary Biology 2022
Quote:
... Primary antibodies (chicken alpha-GFP, Aves Labs: GFP-1010 and rabbit alpha-Ki67 ...
-
No products found
because this supplier's products are not listed.
Carlo Dal Lin, et al.,
bioRxiv - Cell Biology 2020
Quote:
... mouse anti-alpha-tubulin (α-tubulin) (EXBIO Praha, Czech Republic) diluted 1:500 ...