-
No products found
because this supplier's products are not listed.
Xinyue You, et al.,
bioRxiv - Genomics 2019
Quote:
... or 12 μg/mL N-Nitroso-N-ethylurea (ENU, Sigma-Aldrich, MO, USA) for 4 h ...
-
No products found
because this supplier's products are not listed.
Logan D. Morton, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Fisher Scientific):DI water:triisopropylsilane (98%, Fisher Scientific):1,2-ethanedithiol (>98% ...
-
No products found
because this supplier's products are not listed.
Gourav Chakraborty, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... or N-Butyl phosphate (NBP, mixture of mono-N-Butyl phosphate and di-N-Butyl phosphate) of >95% purity (808555, Merck), were prepared by diluting in dimethyl sulfoxide (DMSO) ...
-
No products found
because this supplier's products are not listed.
Godfried Dougnon, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Di (N-succinimidyl) 3,3’-dithiodipropionate (DSP, Tokyo Chemical Industry, Tokyo, Japan)-crosslinking immunoprecipitation (IP ...
-
No products found
because this supplier's products are not listed.
Ayotunde Paul Ikujuni, et al.,
bioRxiv - Biophysics 2022
Quote:
... or 1 % (w/v) n-dodecyl-N,N-dimethylamine-N-Oxide (LDAO, Anatrace) or 1 %(w/v ...
-
No products found
because this supplier's products are not listed.
Ana C. Sias, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and female (GRABDA2h, N =1; GRABDA2m, N = 3) Long Evans rats (Th-cre-littermates, N = 5; Gad-cre-, N = 2; Charles River Laboratories, N = 3) aged 7-9 weeks at the time of surgery were used to record dopamine release in the BLA across Pavlovian trace conditioning ...
-
No products found
because this supplier's products are not listed.
Benkun Zou, et al.,
bioRxiv - Immunology 2021
Quote:
We used DOTAP (N-[1-(2,3-Dioleoyloxy)propyl]-N,N,N-trimethylammonium methyl-sulfate) (Roche) to introduce LPS or oxPLs into cells following the method by Zanoni et al (Zanoni et al. ...
-
No products found
because this supplier's products are not listed.
Till F. M. Andlauer, et al.,
bioRxiv - Genetics 2020
Quote:
... and FOR2107 (n=769 MDD, n=127 BD, n=72 schizophrenia ...
-
No products found
because this supplier's products are not listed.
Marija Fjodorova, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Where indicated cells were pre-incubated with a nitric oxide donor (S)-Nitroso-N-acetylpenicillamine (SNAP, 1000 μM, Tocris) for 24 hours ...
-
No products found
because this supplier's products are not listed.
Quinn K. Langdon, et al.,
bioRxiv - Evolutionary Biology 2023
Quote:
... We continued to sample from these sites for the present analysis (Huextetitla - 21°9’43.82”N 98°33’27.19”W and Santa Cruz - 21°9’27.63”N 98°31’13.79”W). We also added a new site in a different drainage (Fig ...
-
No products found
because this supplier's products are not listed.
Ting-Jui Ben Chang, et al.,
bioRxiv - Biophysics 2022
Quote:
... N,N,N’,N’-Tetramethylethylenediamine (TEMED, 1610801, Bio-Rad), Ammonium persulfate (APS ...
-
No products found
because this supplier's products are not listed.
Beate Kaufmann, et al.,
bioRxiv - Synthetic Biology 2019
Quote:
... using N,N,N’,N’-Tetramethylethylenediamine (Alfa Aesar) and ammonium persulfate (Sigma ...
-
No products found
because this supplier's products are not listed.
Sabine Schneider, et al.,
bioRxiv - Cell Biology 2022
Quote:
... stained with 4-(4-(Dimethylamino)styryl)-N-Methylpyridinium Iodide (4-Di-2-Asp; Abcam, Cat# ab145266) to visualize the enteric nervous system18 ...
-
No products found
because this supplier's products are not listed.
Hailong Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
Adult Fischer F344/N rats (n=12; Male, n=8; Female, n=4) were procured from Envigo Laboratories Inc ...
-
No products found
because this supplier's products are not listed.
Deborah D. Chin, et al.,
bioRxiv - Bioengineering 2020
Quote:
... male (N = 15) or female (N = 15) ApoE−/− mice (Jackson Laboratory) were placed on a Western diet (21% (wt/wt ...
-
No products found
because this supplier's products are not listed.
Balbina J. Plotkin, Ira M. Sigar, Amber Kaminski,
bioRxiv - Cell Biology 2021
Quote:
Effectors for nitric oxide synthesis used in experiments were S-nitroso-N-acetylpenicillamine (SNAP; 50μM; Cayman Chemical), arginine (10mM ...
-
No products found
because this supplier's products are not listed.
Soheila Kazemi, et al.,
bioRxiv - Microbiology 2021
Quote:
... N (Addgene # 64087), P (Addgene # 64088) ...
-
No products found
because this supplier's products are not listed.
Damián Balfagón, et al.,
bioRxiv - Plant Biology 2021
Quote:
... and N-Methyl-N-(trimethylsilyl)trifluoroacetamide (Macherey-Nagel). Fatty acid methyl esters (C8-C24 ...
-
No products found
because this supplier's products are not listed.
Stephanie L. Rayner, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Sections were coverslipped using Di-N-Butyle Phthalate in xylene (DPX, Dako).
-
No products found
because this supplier's products are not listed.
Weiwei Yang, et al.,
bioRxiv - Genomics 2021
Quote:
... 5hmdUTP (N-2059) and 5hmCTP (N-1087) were purchased from Trilink Biotechnologies.
-
No products found
because this supplier's products are not listed.
Kai-En Chen, et al.,
bioRxiv - Biochemistry 2021
Quote:
... The linear peptides DMT1-II550-568 (AQPELYLLNTMDADSLVSR) and palmitoylated CI-MPR2347-2375 with N-terminal di-lysine (KKSNVSYKYSKVNKEEETDENETEWLMEEIQ) were both synthesised by Genscript (USA).
-
No products found
because this supplier's products are not listed.
Gillian Dekkers, et al.,
bioRxiv - Immunology 2020
Quote:
... and 0.1 M 3-(N,N-dimethylamino) propyl-N-ethylcarbonadiimide (GE healthcare) at a flow rate of 5 µL/min ...
-
No products found
Nicholas Hasle, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... black-walled plates (CellVis P06-1.5H-N, P24-1.5H-N, P96-1.5H-N) in phenol-red free media at 5% CO2 and 37 °C using the 20X 0.8 NA objective ...
-
No products found
because this supplier's products are not listed.
Yueyang Wang, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Images were acquired using an N-STORM/N-SIM TIRF microscope (Nikon) with a 1.49/60x Apo TIRF oil objective and a laser-scanning confocal microscope (LSM 800 ...
-
No products found
because this supplier's products are not listed.
Sara Abdul Kader, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... N-Cadherin (Cell signaling, #13116), E-Cadherin (Cell signaling ...
-
No products found
because this supplier's products are not listed.
Christopher Ptak, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Plan Apo N objective (Olympus). Images were collected as 15 x 0.2 μm z-stacks using the SoftWoRx software ...
-
No products found
because this supplier's products are not listed.
Dian Kortleve, et al.,
bioRxiv - Immunology 2024
Quote:
... RNAseq data of 4 databases covering 66 healthy tissues (Uhlen: n=122 individuals, n=32 tissues65; GTEx: n=1,315 individuals, n=53 tissues66; Illumina body map ...
-
No products found
because this supplier's products are not listed.
Jaime A. Osorio-Guarín, et al.,
bioRxiv - Genetics 2019
Quote:
... and 2.0 units of the CspCI enzyme ((N)10-11CAA(N)5GTGG(N)12-13) (New England Biolabs). The library preparation was carried out according to the protocol proposed by Osorio-Guarín et al ...
-
No products found
because this supplier's products are not listed.
Harry C. Tjondro, et al.,
bioRxiv - Biochemistry 2020
Quote:
N-glycans were released from nMPO using Elizabethkingia miricola peptide-N-glycosidase F (Promega) (Jensen et al. ...
-
No products found
because this supplier's products are not listed.
Katy Pilarzyk, et al.,
bioRxiv - Neuroscience 2022
Quote:
... including “#1” that detects all PDE11A4 (GAF-B, n=7M,9F; mCherry, n=3M,3F ...
-
No products found
because this supplier's products are not listed.
Flavia Chiuppesi, et al.,
bioRxiv - Immunology 2020
Quote:
... or N (40588-V08B, Sino Biological). Plates were blocked with 3% BSA in PBS for 2 hours ...
-
No products found
because this supplier's products are not listed.
Vikram Gopal, et al.,
bioRxiv - Microbiology 2021
Quote:
... and N (GeneTex, GTX632269). Membranes were washed in TBS containing 0.1% tween-20 ...
-
No products found
because this supplier's products are not listed.
Milou E. Noltes, et al.,
bioRxiv - Cell Biology 2022
Quote:
Total RNA from patient material (n=3) and organoids (p1 and p2 n=3, p3 n=2) was extracted (RNeasy™ Mini Kit, Qiagen). To obtain cDNA ...
-
No products found
because this supplier's products are not listed.
Wioletta Rut, et al.,
bioRxiv - Biochemistry 2020
Quote:
... and N,N-diisopropylethylamie (DIPEA) from VWR International (Gdansk ...
-
No products found
because this supplier's products are not listed.
Eleonora Centofante, et al.,
bioRxiv - Neuroscience 2024
Quote:
Clozapine-N-oxide (CNO; HelloBio) 3 mg/Kg was dissolved in saline 0.9% and made fresh every other week ...
-
No products found
because this supplier's products are not listed.
Elena Papaleo, et al.,
bioRxiv - Biochemistry 2022
Quote:
... and 500 μM S-nitroso-N-acetylpenicillamine (SNAP) SNAP (Enzo Life Sciences, Switzerland), to induce S-nitrosylation ...
-
No products found
because this supplier's products are not listed.
A.R. von Gundlach, et al.,
bioRxiv - Biophysics 2019
Quote:
... after in situ activation with four equivalents of N,N,N′,N′-Tetramethyl-O-(1H-benzotriazol-1-yl)uronium hexafluorophosphate (HBTU; Carbosynth, Berkshire, United Kingdom) and eight equivalents of N-Methylmorpholine (NMM ...
-
No products found
because this supplier's products are not listed.
Papita Mandal, et al.,
bioRxiv - Biochemistry 2021
Quote:
... 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-(biotinyl) (sodium salt) (di-C 16:0 Biotinyl PE; Avanti Polar Lipids #870285); 1,2-dimyristoyl-sn-glycero-3-phosphoethanolamine (di-C 14:0 PE ...
-
No products found
because this supplier's products are not listed.
Mie Kobayashi-Ishihara, et al.,
bioRxiv - Immunology 2022
Quote:
... pmCherry-N’ (Clontech) between NheI and HindIII restriction sites ...
-
No products found
because this supplier's products are not listed.
Marwa Amer, et al.,
bioRxiv - Biophysics 2022
Quote:
... propyl-3H(N)] (PerkinElmer). For saturation binding experiments ...
-
No products found
because this supplier's products are not listed.
Nicholas J. Thomas, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... CIC (Origene AP50924PU-N,), ETV5 (Cell Signaling 16274) ...
-
No products found
because this supplier's products are not listed.
Deborah. L. W. Chong, et al.,
bioRxiv - Cell Biology 2020
Quote:
... plasma (n=11-47) or BALF (n=6-19) by ELISA (R&D systems, Minneapolis, USA). Active TGFβ1 was quantified by a Mink lung epithelial cell (MLEC ...
-
No products found
because this supplier's products are not listed.
C. A. Heckman, O. M. Ademuyiwa, M. L Cayer,
bioRxiv - Cell Biology 2021
Quote:
1.5 µM ethylene glycol-bis(β-aminoethyl ether)-N,N,N’,N’-tetraacetic acid (EGTA) or 5 µM cyclopiazonic acid (CPA, CalBiochem-EMD Millipore). For Ca2+ replenishment ...
-
No products found
because this supplier's products are not listed.
Ivan L. Simpson-Kent, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Doing so inevitably led to slightly unbalanced numbers of participants with white matter data (CALM: young, N=60 & old, N=105; NKI-Rockland: young, N=19 & old, N=46). To test measurement invariance across age groups (Putnick and Bornstein ...
-
No products found
because this supplier's products are not listed.
Pehuén Pereyra Gerber, et al.,
bioRxiv - Microbiology 2021
Quote:
... pTAG-BFP-N (Evrogen, FP172) was used.
-
No products found
because this supplier's products are not listed.
Takuma Shibata, et al.,
bioRxiv - Immunology 2019
Quote:
... 98%;15N5,96-98%), C(13C9, 98%;15N3,96-98%) and dG(13C10, 98%;15N5,96-98%) were purchased from Cambridge Isotope Laboratories (Massachusetts ...
-
Cat# HY-34758-100 mg,
100 mg, USD $85.0
Ask
Tanmayee Torne-Srivastava, et al.,
bioRxiv - Plant Biology 2023
Quote:
BAPTA-AM: 1,2-Bis(2-aminophenoxy)ethane-N,N,N’,N’-tetraacetic acid tetrakis(acetoxymethyl ester, MCE, MedChemExpress, Monmouth Junction ...
-
No products found
because this supplier's products are not listed.
Kyung Ku Jang, et al.,
bioRxiv - Immunology 2023
Quote:
... 20 mM N-2-hydroxyethylpiperazine-N’-2-ethane sulfonic acid (HEPES, Corning), Minimum Essential Medium (MEM ...
-
No products found
because this supplier's products are not listed.
Muhammad Ahmad, et al.,
bioRxiv - Genetics 2024
Quote:
... a 5x N Plan objective (Leica) was used in the gap junction knockdown experiments ...
-
No products found
because this supplier's products are not listed.
L Simões de Oliveira, et al.,
bioRxiv - Neuroscience 2022
Quote:
... and incubated for an hour at room temperature with secondary antibodies (IRDye 800CW Goat anti Rabbit IgG- 1:10,000, #P/N 925-32211; IRDye 680LT Goat anti Mouse IgG- 1:10,000, #P/N 925-68020, LI-COR Biotechnology). Membranes were washed with TBST1X ...