-
No products found
because this supplier's products are not listed.
Mizuho Nosaka, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... tPA (Mouse tPA ELISA Kit, PA92, Oxford Biomedical Research, Rochester Hills, MI), uPA (Active mouse uPA Functional Assay Kit ...
-
No products found
because this supplier's products are not listed.
Swayam Prakash Srivastava, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Urine albumin levels were assayed using a Mouse Albumin ELISA Kit (Exocell, Philadelphia, PA).
-
This product is a made-to-order Human SORCS1 membrane protein expressed in HEK293. The protein...
Cat# MPC2896K,
1.0 case, Inquiry
Ask
Andrew D. Hoffmann, et al.,
bioRxiv - Immunology 2022
Quote:
... Results were normalized to the CR3022 antibody with known affinity to the receptor binding domain of SARS-CoV2 (Creative Biolabs, MRO-1214LC)(29 ...
-
No products found
because this supplier's products are not listed.
Rachel P. Tillage, et al.,
bioRxiv - Neuroscience 2019
Quote:
... and processed according to the manufacturer’s instructions (Galanin Rat and Mouse ELISA kit, S1208, Peninsula Laboratories, San Carlos, CA). Wells were read at 450 nm ...
-
No products found
because this supplier's products are not listed.
Yasuaki Uehara, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Phosphate homeostasis hormones were measured in mouse and human serum using the FGF-23 ELISA Kit (Kainos Laboratories Inc., Tokyo, Japan), the mouse or human PTH 1-84 ELISA Kit (Immutopics ...
-
No products found
because this supplier's products are not listed.
Edward I. Patterson, et al.,
bioRxiv - Microbiology 2020
Quote:
... and a domain linker ((G4S)4) between the variable heavy (VH) and variable light (VL) domains (Integrative DNA Technologies) (Figure 1B) ...
-
No products found
because this supplier's products are not listed.
Estrela Neto, et al.,
bioRxiv - Cell Biology 2020
Quote:
... a multi-neurotrophin rapid screening ELISA kit (#BEK-2231, Tebu-bio, France) was used according to the manufacturers’ protocol ...
-
No products found
because this supplier's products are not listed.
Kerrie L. Marie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Lot# CA36131)/ 1:400 KDEL Receptor 3 (L95) polyclonal (Bioworld Technology Cat# BS3124 ...
-
No products found
because this supplier's products are not listed.
Qian Shi, et al.,
bioRxiv - Physiology 2022
Quote:
... anti-β2-adrenergic receptor (β2AR) (A-B2AR, Badrilla), anti-β1-adrenergic receptor (β1AR ...
-
No products found
because this supplier's products are not listed.
Nicholas J Swanson, et al.,
bioRxiv - Microbiology 2023
Quote:
... Lyophilized Receptor Destroying Enzyme II (RDE, Hardy Diagnostics) was dissolved into 20 mL of saline (0.9% NaCl in H2O ...
-
No products found
because this supplier's products are not listed.
Seth J. Zost, et al.,
bioRxiv - Immunology 2021
Quote:
... The plates were washed and 25 μL of ELISA buffer containing a 1:4,000 dilution of anti-human IgG alkaline phosphatase conjugate (Meridian Life Science, W99008A) was added ...
-
No products found
because this supplier's products are not listed.
Belinda Liu, et al.,
bioRxiv - Biochemistry 2019
Quote:
... or the insulin receptor signal peptide were synthesized by Eton Biosciences. Similarly ...
-
No products found
because this supplier's products are not listed.
Monica M. Santisteban, et al.,
bioRxiv - Neuroscience 2023
Quote:
... each mouse is placed in a new clean cage containing 5g of nestlet (Ancare) in the middle of the cage ...
-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
LC Laboratories' Product Number G-5903 - GW2580, Free Base (cFMS Receptor Tyrosine Kinase...
Cat# G-5903, SKU# G-5903_10g,
10 g, $2670.00
Ask
Sehar Ali, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... VEGFR2 tyrosine kinase inhibitor (Vatalanib) and colony stimulating factor 1 receptor (CSF1R) inhibitor (GW2580) were purchased from LC Laboratories, Woburn ...
-
No products found
because this supplier's products are not listed.
Shun-saku Takahashi, et al.,
bioRxiv - Cell Biology 2019
Quote:
... followed by N-Histofine® simple stain mouse MAX PO kit (NICHIREI BIOSCIENCES, Japan) using 3,3’-diaminobenzidine ...
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
Rose Z. Hill, et al.,
bioRxiv - Physiology 2023
Quote:
... Slides were incubated in primary antibodies overnight at 4 °C in blocking buffer without serum: AlexaFluor 647-conjugated FluoTag-X4 anti-RFP single domain antibody (Nanotag, N0404, 1:100) or chicken anti-GFP (Aves Labs, GFP1010, 1:1000). When conjugated nanobody was used ...
-
No products found
because this supplier's products are not listed.
Leena Kerr, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Samples containing 4.5 μg of total RNA were depleted for ribosomal RNA using a Ribozero rRNA depletion kit (MRZGP126, Cambio), with depletion confirmed by a Bioanalyzer (Agilent) ...
-
No products found
because this supplier's products are not listed.
Lindsey N. Block, et al.,
bioRxiv - Cell Biology 2021
Quote:
... containing 2% FBS (Peak Serum, Wellington ...
-
No products found
because this supplier's products are not listed.
Hannah C Happ, et al.,
bioRxiv - Genetics 2023
Quote:
... containing Y27632 (10 uM, Reprocell) in a microcentrifuge tube ...
-
No products found
because this supplier's products are not listed.
José Ignacio Gallea, et al.,
bioRxiv - Biophysics 2024
Quote:
... imaging was performed for 2 hours using the imaging buffer from the MASSIVE-SDAB-FAST 2-PLEX kit (Massive Photonics) containing 250 pM Atto 643-labelled Imager F1 supplemented with 80 nm gold nanoparticles (BBI Solutions) at a 1:10 dilution for drift correction ...
-
No products found
because this supplier's products are not listed.
Christopher W. Thomas, et al.,
bioRxiv - Neuroscience 2019
Quote:
... containing a running wheel (Campden Instruments), which were placed within ventilated sound-attenuated Faraday chambers (Campden Instruments) ...
-
No products found
because this supplier's products are not listed.
Mansi Prakash, et al.,
bioRxiv - Neuroscience 2021
Quote:
... containing 2 mg/ml papain (BrainBits). Papain solution was removed ...
-
No products found
because this supplier's products are not listed.
Mariana F. Tioni, et al.,
bioRxiv - Immunology 2021
Quote:
The ELISpot assay was performed using a mouse IFNγ/IL-5 Double-Color ELISPOT assay kit (Cell Technology Limited). Murine IFNγ/IL-5 capture solution and 70% ethanol was prepared according to the manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Estifanos N. Habtemichael, et al.,
bioRxiv - Physiology 2019
Quote:
... containing 10% EquaFETAL bioequivalent serum (Atlas Biologicals), antibiotic antimycotic solution (Sigma) ...
-
No products found
because this supplier's products are not listed.
Ryota Kurimoto, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... containing 0.15 μL of PEI-Max (Polyscience), 20 ng of sensor vector or control sensor (− ...
-
No products found
because this supplier's products are not listed.
Jiechao Zhou, et al.,
bioRxiv - Neuroscience 2022
Quote:
... mouse sera (Complement Technology) was incubated with C1q (4.8 ...
-
No products found
because this supplier's products are not listed.
Laura Zein, et al.,
bioRxiv - Cell Biology 2023
Quote:
... mouse anti-GAPDH (Hytest Cat# 5G4cc-6C5cc ...
-
No products found
because this supplier's products are not listed.
Eric E. Irons, et al.,
bioRxiv - Immunology 2019
Quote:
... twice dehydrated in xylene-containing HistoClear (National Diagnostics), then rehydrated in successive ethanol solutions ...
-
No products found
because this supplier's products are not listed.
Thanh Kha Phan, et al.,
bioRxiv - Cell Biology 2023
Quote:
... containing five steel homogenization beads (Next Advance Inc). Lung homogenates were then centrifuged at 10,000 g for 5 min at 4°C ...
-
No products found
because this supplier's products are not listed.
Wenwei Li, et al.,
bioRxiv - Microbiology 2021
Quote:
... and homogenized in 1 mL of serum free RPMI media containing penicillin-streptomycin and homogenized in 2 mL tube containing 1.5 mm Zirconium beads with BeadBug 6 homogenizer (Benchmark Scientific, TEquipment Inc). Virus titers were measured using three highly correlative methods ...
-
No products found
because this supplier's products are not listed.
Roya Yousefi, et al.,
bioRxiv - Biochemistry 2020
Quote:
... ANK-G (mouse, Antibodies incorporated), SYP (guinea pig ...
-
No products found
because this supplier's products are not listed.
Hong-Gyun Lee, et al.,
bioRxiv - Immunology 2024
Quote:
... containing 20 mM Tris-HCl (pH 7.5) (Teknova, #T5075), 1000 mM LiCl (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Deanna M. Marchionini, et al.,
bioRxiv - Neuroscience 2022
Quote:
... blocked in 10% normal goat serum/ 10% mouse- on-mouse blocking (ScyTek Laborities, No. MTM015)/ TBS ...
-
No products found
because this supplier's products are not listed.
Justin Judd, Jonathan Lovas, Guo N. Huang,
bioRxiv - Developmental Biology 2019
Quote:
... pH 7) containing 10 uM Sulfo-Cyanine5 azide dye (Lumiprobe) was applied for 10-20 minutes at room temperature ...
-
No products found
because this supplier's products are not listed.
Fei Li, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... and 0.5% blocking solution (Roche)] containing 100nM telomeric PNA probe TelC-FITC (F1009, PNA Bio), and hybridization was continued for 2 h at room temperature in the dark moisturized chambers ...
-
No products found
because this supplier's products are not listed.
Mélanie Roussat, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... γ-Tubulin (Exbio, 1:1000, mouse), CTIP2 (abcam ...
-
No products found
because this supplier's products are not listed.
Edmundo G. Vides, et al.,
bioRxiv - Biochemistry 2022
Quote:
... mouse anti-Rab10 (1:1000, Nanotools); and rabbit anti-phospho Rab10 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Jens O. Watzlawik, et al.,
bioRxiv - Neuroscience 2024
Quote:
... the supernatant of each single B cell well was screened for antigen specificity through direct ELISA for targeting full-length monomeric p-S65-Ub protein (Boston Biochem, U-102), free p-S65-Ub peptides 1 and 2 and BSA-conjugated p-S65-Ub peptides 1 and 2 (provided by 21st Century Biochemicals) ...
-
No products found
because this supplier's products are not listed.
Yanrui Yang, et al.,
bioRxiv - Cell Biology 2020
Quote:
... mouse anti-His (CoWin Biosciences, Jiangsu, China), rabbit anti-calmodulin (Boster Biological Technology ...
-
No products found
because this supplier's products are not listed.
Eleni Kafkia, et al.,
bioRxiv - Systems Biology 2020
Quote:
... mouse anti-lamin B1 (1:500, Atlas Antibodies, AMAb91251) and anti-mouse Alexa Fluor 555 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Soham Chakraborty, et al.,
bioRxiv - Biophysics 2022
Quote:
... A PBS solution containing the reference bead (2.5-2.9 μm, Spherotech, AP-25-10) was then passed and incubated for 15 minutes ...
-
No products found
because this supplier's products are not listed.
Jiang Wang, et al.,
bioRxiv - Plant Biology 2022
Quote:
... using a separation column containing Rezex™ RCM-Monosaccharide Ca2+ (8%) (Phenomenex, Torrance, CA). The average of three independent repeats was used for calculation.
-
No products found
because this supplier's products are not listed.
Qi Ma, Hongyu Ruan, Huihui Dai, Wei-Dong Yao,
bioRxiv - Neuroscience 2023
Quote:
... DUAL hybrid cDNA Library -mouse cortical neurons (Bulldog Bio, P12401) and reverse primer ...
-
No products found
because this supplier's products are not listed.
Nigel Dao, Dakota F. Brockway, Nicole A. Crowley,
bioRxiv - Neuroscience 2019
Quote:
... 150 µM slices containing the PLC were dissected on a Compresstome (Precisionary Instruments, Greenville, NC) and transferred to normal aCSF for 30 min ...
-
No products found
because this supplier's products are not listed.
Timothy N. Hoang, et al.,
bioRxiv - Immunology 2020
Quote:
... and Mouse Polink-2 HRP (GBI Labs; Cat. No. D37-110 for Mx1). Slides were developed using Impact™ DAB (3,3′-diaminobenzidine ...
-
No products found
because this supplier's products are not listed.
Taiyi Kuo, Domenico Accili,
bioRxiv - Physiology 2020
Quote:
... and NEFA kit (Wako Diagnostics).
-
No products found
because this supplier's products are not listed.
Ankita B. Jaykumar, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... and mycoplasma-free (e-Myco Kit, Boca Scientific or Universal Mycoplasma Detection Kit 30-1012K ...
-
No products found
because this supplier's products are not listed.
Matthew Patrick, et al.,
bioRxiv - Bioengineering 2023
Quote:
... or a Picro-Sirius Red staining kit (StatLab), following the respective manufacturer’s instructions or immunohistochemistry (IHC ...