-
No products found
because this supplier's products are not listed.
Richard J. Burt, et al.,
bioRxiv - Cancer Biology 2023
Quote:
A double-stranded RNA ELISA kit (Exalpha/Nordic Mubio) was used to quantify dsRNA from 1ug of total RNA ...
-
No products found
because this supplier's products are not listed.
Chen Jiang, et al.,
bioRxiv - Cell Biology 2020
Quote:
... at 37°C in a CO2 humidified incubation chamber in cell culture medium (CnT-07, Cellntec).
-
No products found
because this supplier's products are not listed.
Kiryu K. Yap, et al.,
bioRxiv - Cell Biology 2023
Quote:
Human coagulation factor VIII levels in the mouse plasma were measured using a factor VIII enzyme-linked immunosorbent assay (ELISA) kit (Affinity Biologicals), following manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Samia Bouamama, Amina Bouamama,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
An enzyme-linked immunosorbent assay (ELISA) kit was used to determine the levels of IL-2 cytokine released in PBMC free supernatants (Abfrontier, Multiplex Human Cytokine ELISA Kit).
-
No products found
because this supplier's products are not listed.
Hannah Donnelly, et al.,
bioRxiv - Bioengineering 2024
Quote:
... Enzyme-linked immunosorbent assays (ELISA) was then carried out as per manufacturer’s instructions (R&D Systems, BMP-2 DuoSet ELISA kit, DY355). Briefly ...
-
No products found
because this supplier's products are not listed.
Jimi L. Rosenkrantz, et al.,
bioRxiv - Developmental Biology 2021
Quote:
BeWo cells were cultured at 37°C 5% CO2 in Ham’s F-12 (Kaighn’s Modification) media (Caisson Labs, HFL06-500ML) supplemented with 10% FBS (Sigma ...
-
No products found
because this supplier's products are not listed.
Blake L. Cooper, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... Cells were maintained under standard cell culture conditions (37°C, 5% CO2) in iCell cardiomyocyte maintenance media (Fujifilm Cellular Dynamics) supplemented with 1 mg/mL ciprofloxacin (Sigma Aldrich) ...
-
No products found
because this supplier's products are not listed.
Hajera Amatullah, et al.,
bioRxiv - Immunology 2021
Quote:
... Topoisomerase II activity assay was performed according to the manufacturer’s instructions (Topoisomerase II activity assay kit, TopoGen). Briefly ...
-
No products found
because this supplier's products are not listed.
Armand O. Brown, et al.,
bioRxiv - Microbiology 2020
Quote:
... inflammatory chemokines and cytokines were additionally analyzed using a Mouse Cytokine ELISA Plate Array III Colorimetric Assay (Signosis). The data represent an average of at least 3 independent experiments for each strain and were analyzed using Student’s two-tailed t-test.
-
No products found
because this supplier's products are not listed.
Carina C D Joe, et al.,
bioRxiv - Bioengineering 2021
Quote:
Residual host-cell protein (HCP) was quantified using the HEK293 HCP ELISA kit (Cygnus Technologies) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Di Wan, Tongchuang Lu, Chenyang Li, Changlong Hu,
bioRxiv - Neuroscience 2023
Quote:
... cAMP levels in hippocampal neurons were measured using a cAMP ELISA Kit (NewEast Bioscience, China) following the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Siamak Salavatian, et al.,
bioRxiv - Neuroscience 2023
Quote:
... 1 µL of an enzyme solution containing 1 U glutamate oxidase (Cosmo Bio USA, Carlsbad, CA, USA), 13.7 mg bovine serum albumin (Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Robert J. Fialkowski, et al.,
bioRxiv - Physiology 2022
Quote:
Oxidative DNA damage was evaluated for 8-OhDG damage using a DNA damage ELISA kit (StressMarq Biosciences Inc.) (Fialkowski et al. ...
-
No products found
because this supplier's products are not listed.
Paresh P Kulkarni, et al.,
bioRxiv - Cell Biology 2023
Quote:
Protein C activity in WT and Apoh-/- plasma was performed using the Chromogenix Coamatic Protein C activity kit (Diapharma). Briefly ...
-
No products found
because this supplier's products are not listed.
Debjani Pal, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and reverse transcription was performed using the SuperScript II RT kit (Integrative DNA Technologies) with total RNA (1 μg ...
-
No products found
because this supplier's products are not listed.
Marin Boutonnet, et al.,
bioRxiv - Neuroscience 2023
Quote:
... human angiotensin II (HelloBio®); N-Methyl-D-Aspartate (NMDA ...
-
No products found
because this supplier's products are not listed.
K. Elkie Peebles, et al.,
bioRxiv - Cell Biology 2023
Quote:
... nos-Cas9 (II-attp40) by BestGene Inc ...
-
No products found
because this supplier's products are not listed.
Kevin M. Knox, et al.,
bioRxiv - Neuroscience 2021
Quote:
... FluoroJade-C (FJ-C; catalog #1FJC) was from Histo-Chem Inc (Jefferson ...
-
No products found
because this supplier's products are not listed.
Yuichiro Honda, et al.,
bioRxiv - Pathology 2020
Quote:
... The sections were blocked with 5% bovine serum albumin in PBS for 60 min and incubated overnight at 4°C with a mouse anti-CD-11b primary antibody (1:2000; BMA Biomedicals, Augst, Switzerland) or a rabbit polyclonal anti-dystrophin primary antibody (1:1000 ...
-
No products found
because this supplier's products are not listed.
Barbara Ciralli, et al.,
bioRxiv - Neuroscience 2023
Quote:
... cannabinol (Cerilliant C-046) and CBD (Cerilliant C-045 ...
-
No products found
because this supplier's products are not listed.
Giuseppe Ianiri, et al.,
bioRxiv - Genetics 2019
Quote:
... Then the block was critical-point dried with liquid CO2 and sputter coated with 50 Å of gold/palladium with a Hummer 6.2 sputter coater (Anatech). The samples were viewed at 15KV with a JSM 5900LV scanning electron microscope (JEOL ...
-
No products found
because this supplier's products are not listed.
Samuel P. Brown, et al.,
bioRxiv - Neuroscience 2023
Quote:
... The cerebellum was sliced sagittally in ice-cold cutting solution saturated with 95% O2/5% CO2 using a Compresstome VF-300 (Precisionary Instruments) at 350 µM thickness ...
-
No products found
because this supplier's products are not listed.
Madeleine Moore, et al.,
bioRxiv - Cancer Biology 2023
Quote:
Mice were sacrificed by CO2 following with cervical dislocation and whole livers were harvested and ground in a liquid nitrogen chilled Cryocooler (OPS diagnostics). Sample powder was then lysed for 5 minutes on ice using lysis buffer (15 mM TrisHCl (pH 7.4) ...
-
No products found
because this supplier's products are not listed.
Ainelen Piazza, et al.,
bioRxiv - Microbiology 2022
Quote:
The quantification of c-di-GMP levels was performed using the Cyclic-di-GMP Assay Kit from Lucerna (Catalog Number: 200-100). Cultures of the strains were adjusted to OD600 = 0.2 and set up for the assay in 30-µl aliquots along with assay reagents and serially diluted c-di-GMP standards ...
-
No products found
because this supplier's products are not listed.
Thekla Cordes, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... The cell suspension was centrifuged at 20,000 g for 10 min at 4 °C and 20 µl of the supernatant was used for protein quantification using BCA protein assay kit (Cat. #G1002, Lamda Biotech. Inc) as per manufacturer’s instruction.
-
No products found
because this supplier's products are not listed.
Mitchell R. Lewis, Tara L. Deans,
bioRxiv - Synthetic Biology 2023
Quote:
Mouse embryonic stem cells (harvested from a TARGATT mouse, Applied StemCell) (see Note 1).
-
No products found
because this supplier's products are not listed.
Mengjie Li, et al.,
bioRxiv - Microbiology 2024
Quote:
Total RNA was extracted from mouse lung tissue using an RNA extraction kit according to the manufacturer’s instructions (BioMiGA, China). All materials required for the experiment were treated with DPEC water to remove RNA enzyme (BioMiGA ...
-
No products found
because this supplier's products are not listed.
Galit H. Frydman, et al.,
bioRxiv - Immunology 2019
Quote:
... 10 µL of cells were then imaged on a disposable C-Chip hemocytometer (In Cyto, SKC, Inc. C-Chip) using a 10X and 20X objective on a Nikon TiE fluorescent microscope ...
-
No products found
because this supplier's products are not listed.
Hejian Xiong, et al.,
bioRxiv - Bioengineering 2022
Quote:
Cryopreserved primary mouse neurons derived from the striatum of day 18 embryonic CD1 mouse brain (Cat. # M8812N-10) and the culture kit (Cat. # M8812NK-10) were purchased from Cell Applications, Inc ...
-
No products found
because this supplier's products are not listed.
Wu Liu, et al.,
bioRxiv - Microbiology 2019
Quote:
... equipped with a ProScan II motorized flat top stage (Prior Scientific, USA). With this setup ...
-
No products found
because this supplier's products are not listed.
Emily K. Sims, et al.,
bioRxiv - Pathology 2019
Quote:
... Three of the donors with type 1 diabetes had detectable random serum C-peptide and 13 were classified by nPOD as C-peptide negative (random serum C-peptide <0.017nmol/L via TOSOH immunossay) (12) ...
-
No products found
because this supplier's products are not listed.
Simone Kurz, et al.,
bioRxiv - Biochemistry 2020
Quote:
... mouse brain (Pel-Freez Biologicals), or HEK293 cells (kind gift from Dr ...
-
No products found
because this supplier's products are not listed.
Yi-Nan Zhang, et al.,
bioRxiv - Immunology 2021
Quote:
... Recombinant mouse Flt3 ligand (Flt3L) and mouse SCF were purchased from Shenandoah Biotech (Warwick, PA). Cells were stained with appropriate concentrations of mAbs ...
-
No products found
because this supplier's products are not listed.
Cinzia Klemm, Gudjon Olafsson, Peter H Thorpe,
bioRxiv - Cell Biology 2023
Quote:
3xFLAG-tagged Mif2CENP-C cells were harvested after 4 hours of growth at restrictive (37°C) or permissive (23°C) temperature and whole cell lysates were prepared using glass beads and a cell disrupter (Scientific Industries Inc.) in Laemmeli buffer containing an EDTA-free protease inhibitor cocktail (Thermo Fisher) ...
-
No products found
because this supplier's products are not listed.
Satish Rojekar, et al.,
bioRxiv - Bioengineering 2023
Quote:
... or at 37 °C in a water bath (PolyScience), and analyzed by dynamic light scattering or protein thermal shift assay ...
-
No products found
Richard J. Roller, et al.,
bioRxiv - Microbiology 2021
Quote:
... or mouse anti-VP5 (Biodesign. International) 1:500 ...
-
No products found
because this supplier's products are not listed.
Alexis Vivoli, et al.,
bioRxiv - Cell Biology 2021
Quote:
... islets were washed once with D-PBS + 2 mM EDTA solution (339xg, 3 min, 4°C) and digested by enzymatic disaggregation for 10 min at 37°C using Accutase (Innovative Cell Technologies Inc., San Diego, CA, USA). The reaction was stopped using islet culture medium and the islet cell suspension was washed once with PBS and dead cells labeled using the LIVE/DEAD™ Fixable Aqua Dead Cell Stain Kit (405 nm ...
-
No products found
because this supplier's products are not listed.
Surya Cayre, et al.,
bioRxiv - Developmental Biology 2020
Quote:
The following primary antibodies were used on mouse cell-derived lysates: anti-mouse milk proteins (Accurate Chemical; YNRMMSP; 1/2000), anti-mouse b-casein (a kind gift from C ...
-
No products found
because this supplier's products are not listed.
JP Johnson Jr, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
K2EDTA Blank mouse plasma purchased from Valley Biomedical, California ...
-
No products found
because this supplier's products are not listed.
Matthew Pierpoint, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Chromosomes were incubated in Tel C Cy 3 PNA probe (PNA Bio) at 83 °C for 5 minutes and allowed to hybridize at room temperature in a dark hybridization chamber for 2 hours at room temperature ...
-
No products found
because this supplier's products are not listed.
Gabriela Zurawska, et al.,
bioRxiv - Cell Biology 2023
Quote:
... mice received i.v.solution of liposomes containing clodronic acid (LIPOSOMA, #C-SUV-005) (5 ml/kg ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Colin K.W. Lim, et al.,
bioRxiv - Bioengineering 2022
Quote:
Harvested cells or nuclei were strained using a 35 μm filter and sorted using a BD FACSAria II Cell Sorter (Roy J. Carver Biotechnology Center Flow Cytometry Facility ...
-
No products found
because this supplier's products are not listed.
Carl-Fredrik Bowin, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... Venus fluorescence was measured first and subsequently 10 µl of Coelenterazine h (Biosynth C-7004) (2.5 µM final concentration ...
-
No products found
because this supplier's products are not listed.
Hitika Gulabani, et al.,
bioRxiv - Plant Biology 2021
Quote:
... rinsed and incubated overnight at 4°C with indicated primary antibodies [anti-SNC1 (Abiocode; R3588-1), anti-PR1 ...
-
No products found
because this supplier's products are not listed.
Klaudia K. Maruszczak, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 4°C) and the clarified supernatant was applied to a nickel affinity resin column (Cube Biotech). The column was first washed with the buffer mentioned above supplemented with 10 mM imidazole ...
-
No products found
because this supplier's products are not listed.
Embriette R. Hyde, Hiram Lozano, Steven Cox,
bioRxiv - Microbiology 2020
Quote:
... Chilled (4°C) and pre-reduced anaerobically sterilized (PRAS) dilution blank medium (AS-9183, Anaerobe Systems) was added at a volume of 2:1 (2mL per gram ...
-
No products found
because this supplier's products are not listed.
Yukiko Yamaguchi, et al.,
bioRxiv - Immunology 2022
Quote:
Collected mouse tissue was fixed in 4% paraformaldehyde (4% PFA, Boston BioProducts) and stored in 70% ethanol until processed further ...
-
No products found
because this supplier's products are not listed.
Rebekah P. Dyer, et al.,
bioRxiv - Biochemistry 2020
Quote:
... then lysed at 23 °C with shaking at 500 rpm for 30 min in DWP Lysis Buffer: 100 μL per well of SoluLyse (Genlantis) plus benzonase nuclease (75 U/mL ...
-
No products found
because this supplier's products are not listed.
Derin Sevenler, Mehmet Toner,
bioRxiv - Bioengineering 2023
Quote:
... The Ultra Rainbow Calibration bead kit (Spherotech URCP-38-2k) consists of 3.8 µm polystyrene particles which contain embedded six different fluorochromes that align to the most common flow cytometry excitation and emission filter sets ...