-
No products found
because this supplier's products are not listed.
Barbara Ciralli, et al.,
bioRxiv - Neuroscience 2023
Quote:
... cannabinol (Cerilliant C-046) and CBD (Cerilliant C-045 ...
-
No products found
because this supplier's products are not listed.
Eric E. Gardner, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... and Fc receptor blocker reagent (Innovex Biosciences; 1:25). Slides were then briefly washed in TBST and primary antibodies were incubated overnight in blocking buffer at 4C in a humidified chamber ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Kazutoshi Takahashi, et al.,
bioRxiv - Cell Biology 2020
Quote:
... line was cultured on mitomycin C (MMC)-inactivated SNL mouse feeder cells (RRID:CVCL_K227) in Primate ESC Culture medium (ReproCELL) supplemented with 4 ng/ml bFGF.
-
No products found
because this supplier's products are not listed.
Takumi Chinen, et al.,
bioRxiv - Cell Biology 2020
Quote:
... proTAME (APC/C inhibitor, I-440, Boston Biochem), Cytochalasin B (actin inhibitor ...
-
No products found
because this supplier's products are not listed.
Christine Chevalier, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Immunostaining was performed overnight at +4°C with primary antibodies (H3K4me2 1:1000; Abcam ab32356) (H3K4me3 1:200; Diagenode C15410003) (H3K4me2 1:1000; EpiGentek A4032) (LAMP1 1:1000 ...
-
No products found
because this supplier's products are not listed.
Saejeong Park, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... fixed in warm 4% paraformaldehyde (Thomas Scientific, 37 °C) for 5 min and washed with PBS 3 times ...
-
No products found
because this supplier's products are not listed.
Vivian Salgueiro, et al.,
bioRxiv - Microbiology 2023
Quote:
... samples were hydrolyzed overnight in 6N HCl at 100°C in 1 ml capacity-crystal ampoules (Wheaton). Samples were dried and resuspended in water and mixed in a 1:1:1 ratio with pure acetic acid and ninhydrin reagent (250 mg ninhydrin ...
-
No products found
because this supplier's products are not listed.
Jenna J. Guthmiller, et al.,
bioRxiv - Immunology 2021
Quote:
... 1 part serum was treated with 3 parts Receptor Destroying Enzyme II (Seiken, Hardy Diagnostics) for 18 hours at 37°C ...
-
No products found
because this supplier's products are not listed.
Eriko Ohgitani, et al.,
bioRxiv - Microbiology 2021
Quote:
... and RNA was extracted using TRI Reagent(C) LS (Molecular Research Center, Inc. ...
-
No products found
because this supplier's products are not listed.
M. Martinez, et al.,
bioRxiv - Microbiology 2023
Quote:
... at 4°C and loaded 3 times in a CellD disrupter (Constant Systems). The lysate was centrifuged for 15min at 12000 x g at 4°C to remove cell debris and the supernatant was centrifuged again for 1h at 100000 x g at 4°C ...
-
No products found
because this supplier's products are not listed.
Martin Dlask, et al.,
bioRxiv - Biophysics 2019
Quote:
We used a measurement system based on cooled (−30 °C) low-noise photomultiplier tube (PMT) R2256-02 (all components of the system from Hamamatsu Photonics Deutschland ...
-
No products found
because this supplier's products are not listed.
Sami T. Tuomivaara, et al.,
bioRxiv - Biochemistry 2023
Quote:
... supplemented with 2% in-house heat-treated (56 °C for 30 min) FBS (Atlanta Biologicals) and GlutaMAX (for proteomics) ...
-
No products found
because this supplier's products are not listed.
Magdalena Miranda, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Temperature was controlled with a servo-controlled heating pad (37°C ± 0.5; Fine Science Tools, Vancouver, Canada). Craniotomies for tetrode implantation were drilled in the skull above the CA3 (AP ...
-
No products found
because this supplier's products are not listed.
Joanna J. Moss, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... and anti-mouse (G32-62G, 1:10,000, SignalChem) horseradish peroxidase-conjugated antibodies at room temperature for 1 hr before exposure on photographic film (28906844 ...
-
No products found
because this supplier's products are not listed.
Michael F. Priest, et al.,
bioRxiv - Neuroscience 2021
Quote:
Viral vectors were stored at -80 °C prior to use and were backfilled into Wiretrol II pipettes (Drummond Scientific Company) pulled on a P-1000 Flaming/Brown micropipette puller (Sutter Instruments) ...
-
No products found
because this supplier's products are not listed.
Toby Buttress, et al.,
bioRxiv - Plant Biology 2021
Quote:
Sequences for H2B.8 and H2B.2 were cloned into the pET28a+ vector with a non-cleavable C-terminal 8×His-tag and then transformed to Escherichia coli strain BL21 (Tiangen). Cells were grown to OD 0.8 at 37 °C in LB media with 30 μg/ml kanamycin ...
-
No products found
because this supplier's products are not listed.
Kerstin Menck, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... boiled for 5 min at 95°C and printed in triplicates onto nitrocellulose-coated glass slides (Oncyte Avid, Grace Bio-Labs). For blocking ...
-
No products found
because this supplier's products are not listed.
Daniel Mott, et al.,
bioRxiv - Immunology 2023
Quote:
BioMag®Plus Amine protein coupling kit (Bangs Laboratories Inc.) (Catalog #86000-1 ...
-
No products found
because this supplier's products are not listed.
Arun Upadhyay, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Arg-C (Biovendor, Cat#RBG40003005), trypsin (Promega ...
-
Cat# CT235-1,
USD $675.0/mg
Ask
Remigiusz A. Serwa, et al.,
bioRxiv - Microbiology 2019
Quote:
... monoclonal mouse anti-VP5 capsid protein(1:2500, Virusys) and rabbit anti-gE/I anti-sgE/I envelop protein (1:1000 ...
-
No products found
because this supplier's products are not listed.
Benoît P. Nicolet, et al.,
bioRxiv - Immunology 2019
Quote:
... were pre-coated overnight at 4°C with 4μg/mL rat α-mouse IgG2a (MW1483, Sanquin) in PBS ...
-
No products found
because this supplier's products are not listed.
Natalia Gebara, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... and 2% Chang Medium C (Irvine Scientific), 20% Fetal Calf Serum (Invitrogen ...
-
No products found
because this supplier's products are not listed.
Lesia Rodriguez, et al.,
bioRxiv - Plant Biology 2022
Quote:
... affinity-purified TMK1 (1:1000, 59), AHA2 (1:1000, 73) and PIN2 (1:1000, 35) antibodies and anti-ROP6 (C) (1:1000, Abiocode), using anti-Rabbit HRP-conjugated (1:5000 ...
-
No products found
because this supplier's products are not listed.
Luis F. Garcia-Alles, et al.,
bioRxiv - Biochemistry 2019
Quote:
... protein tags were removed by incubation overnight at 25°C with turbo TEV protease (GenWay, 5 μg/mL final) in 50 mM Tris pH 8.0 / 300 mM NaCl /2 mM DTT/ 1 mM EDTA ...
-
No products found
because this supplier's products are not listed.
Mengqi Luo, et al.,
bioRxiv - Biochemistry 2022
Quote:
... overnight at 4 °C and then HRP-conjugated secondary antibody (1:2000, ZEN BIO, China) for 1 hour at room temperature ...
-
No products found
because this supplier's products are not listed.
Kenneth Johnson, et al.,
bioRxiv - Microbiology 2022
Quote:
... at 37°C in flow chambers (IBI scientific, UK). The system was sterilized by pumping a 0.2 % of hypochlorite solution for 1 hour using a peristaltic pump ...
-
No products found
because this supplier's products are not listed.
Yisi Liu, et al.,
bioRxiv - Cell Biology 2023
Quote:
... PCDNA3.1Relb and pcDNA3.1 C/EBPβ were purchased from GENEWIZ. CXCR4 3’UTR was co-transfected with mir-193a-5p mimic by HEK293 cells ...
-
No products found
because this supplier's products are not listed.
Mathew Miller, et al.,
bioRxiv - Molecular Biology 2022
Quote:
MULTI-ARRAY Standard 96-well plates (Meso Scale Diagnostics, Rockville, Maryland) were coated overnight at 4°C with K1 anti-dsRNA mouse monoclonal antibody (SCICONS, Budapest, Hungary). Plates were blocked using 5% MSD Blocker A (Meso Scale ...
-
No products found
because this supplier's products are not listed.
Owen J. Chen, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... MEFs were maintained at 37°C in DMEM (Wisent Bioproducts: 4.5 g/L glucose ...
-
No products found
because this supplier's products are not listed.
Luke Borchardt, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
Flies were fed a nonabsorbable blue dye (FD&C blue dye no. 1©, Spectrum Chemical MFG Corp.) at a concentration of 2.5% in standard food ...
-
No products found
because this supplier's products are not listed.
Federico Salas-Lucia, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Images were obtained using a transmission electron microscope (JEOL-100 C).
-
No products found
because this supplier's products are not listed.
Yurika Matsui, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... cells were incubated at 37 °C with reconstituted FAM-FLICA® at a 1:300 dilution (ImmunoChemistry Technologies 94) for 30 min ...
-
No products found
because this supplier's products are not listed.
Alexis Vivoli, et al.,
bioRxiv - Cell Biology 2021
Quote:
... islets were washed once with D-PBS + 2 mM EDTA solution (339xg, 3 min, 4°C) and digested by enzymatic disaggregation for 10 min at 37°C using Accutase (Innovative Cell Technologies Inc., San Diego, CA, USA). The reaction was stopped using islet culture medium and the islet cell suspension was washed once with PBS and dead cells labeled using the LIVE/DEAD™ Fixable Aqua Dead Cell Stain Kit (405 nm ...
-
No products found
because this supplier's products are not listed.
Qian Shi, et al.,
bioRxiv - Physiology 2022
Quote:
... anti-β2-adrenergic receptor (β2AR) (A-B2AR, Badrilla), anti-β1-adrenergic receptor (β1AR ...
-
No products found
because this supplier's products are not listed.
Theodora U. J. Bruun, et al.,
bioRxiv - Biochemistry 2022
Quote:
... were coated with antigen at 1 μg/mL in 50 mM bicarbonate pH 8.75 for 1 h at room temperature then blocked overnight at 4 °C with ChonBlock Blocking/Dilution ELISA buffer (Chondrex). In the case of biotinylated antigens ...
-
No products found
because this supplier's products are not listed.
Ignasi Casanellas, et al.,
bioRxiv - Bioengineering 2021
Quote:
... immunostained with anti-C×43 antibody and Sir-Actin (Tebu-bio, SC001), and imaged with a Zeiss LSM780 Confocal Microscope (Zeiss Microscopy ...
-
No products found
because this supplier's products are not listed.
Yiwu Yan, et al.,
bioRxiv - Cancer Biology 2020
Quote:
The c-Myc activity was assessed using the Myc Reporter kit (BPS Biosciences) and the Dual-Luciferase Reporter System (Promega ...
-
No products found
because this supplier's products are not listed.
Ambre Guillory, et al.,
bioRxiv - Plant Biology 2024
Quote:
... and homogenized in GUS extraction buffer before 1 µg of total protein extracts were used for enzymatic reactions at 37°C using 1 mM of the 4-MUG substrate (4-Methylumbelliferyl-β-D-glucuronide hydrate, Biosynth M-5700). GUS activity was measured using a FLUOstar Omega 96 microplate reader (BMG LABTECH ...
-
No products found
because this supplier's products are not listed.
Kelly Snead, et al.,
bioRxiv - Biochemistry 2022
Quote:
... at 4°C using 40µL bed volume (BV) nickel-charged IMAC tips (Biotage, Uppsala, Sweden). The columns were washed in a 96-well deepwell plate with 20BV dH2O and then equilibrated in 20BV of 20mM HEPES pH 7.4 ...
-
No products found
because this supplier's products are not listed.
Toshiyuki Oda, et al.,
bioRxiv - Immunology 2022
Quote:
... and 4 µl of HMC buffer containing cytochrome c-stabilized 15-nm colloidal gold (BBI Solutions) was applied for attachment of fiducial markers (Oda et al. ...
-
No products found
because this supplier's products are not listed.
Edmundo G. Vides, et al.,
bioRxiv - Biochemistry 2022
Quote:
... mouse anti-Rab10 (1:1000, Nanotools); and rabbit anti-phospho Rab10 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Panga Jaipal. Reddy, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Analytical column (PICOCHIP: 105 cm, 1.9 µm, REPROSIL Pur C-18-AQ, 120 Å, New Objective, USA) with a flow rate of 300 nL/min was used for the separation of the peptides with a linear gradient of 5–35% buffer-B (90% acetonitrile in 0.1% FA ...
-
No products found
because this supplier's products are not listed.
Mansi Prakash, et al.,
bioRxiv - Neuroscience 2021
Quote:
... tissue was incubated for 10 min at 30°C in Hibernate E (minus calcium and B27 supplement; HEB, BrainBits) containing 2 mg/ml papain (BrainBits) ...
-
No products found
because this supplier's products are not listed.
Jimi L. Rosenkrantz, et al.,
bioRxiv - Developmental Biology 2021
Quote:
BeWo cells were cultured at 37°C 5% CO2 in Ham’s F-12 (Kaighn’s Modification) media (Caisson Labs, HFL06-500ML) supplemented with 10% FBS (Sigma ...
-
No products found
because this supplier's products are not listed.
A Elgheznawy, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Platelets were activated with appropriately diluted agonists for 8 min at 37°C followed by 8 min at RT in the presence of saturating amounts of PE-coupled JON/A (4H5, Emfret Analytics) detecting activated αIIbβ3 integrin and FITC-coupled anti-P-selectin (Wug.E9 ...
-
No products found
because this supplier's products are not listed.
W. Coles Keeter, et al.,
bioRxiv - Immunology 2023
Quote:
... 8-12-week-old male mice were placed on a high fat diet with 0.15% added cholesterol (HFD-C, fat: 60% kcal; carbohydrate: 26% kcal, Bio-Serv F3282) for 28 weeks until sacrifice.
-
No products found
because this supplier's products are not listed.
Li Dai, et al.,
bioRxiv - Biophysics 2021
Quote:
... 1% w/v 800 nm Protein G-coated polystyrene beads (Spherotech Inc) were washed in the same way as the streptavidin beads ...
-
No products found
because this supplier's products are not listed.
Seren Hamsici, Gokhan Gunay, Handan Acar,
bioRxiv - Bioengineering 2022
Quote:
... Fmoc protected amino acids (Gyros Protein Technologies) were removed through treatment with 20% piperidine/DMF solution for 45 min (three times for 15 min ...
-
No products found
because this supplier's products are not listed.
Audrey Tze Ting Khoo, et al.,
bioRxiv - Neuroscience 2020
Quote:
... the same solution containing the primary antibody overnight at 4°C (anti-tRFP, 1:1000, Evrogen; anti-GABA, 1:2000, MilliporeSigma anti-parvalbumin, 1:2000, Abcam; anti-somatostatin, 1:1000, Peninsula Laboratories) (iii ...