-
No products found
because this supplier's products are not listed.
Jin-Ran Chen, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Serum bone resorption marker C-terminal telopeptides of type I collagen (CTX-1) was measured by Rat-LapsTM ELISA from Nordic Biosciences Diagnostic (Herlev ...
-
No products found
because this supplier's products are not listed.
Di Wan, Tongchuang Lu, Chenyang Li, Changlong Hu,
bioRxiv - Neuroscience 2023
Quote:
... cAMP levels in hippocampal neurons were measured using a cAMP ELISA Kit (NewEast Bioscience, China) following the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Kartika Padhan, et al.,
bioRxiv - Immunology 2020
Quote:
... We sorted 1-2 million cells from each cell types for experiments involving FCS2 chamber (Bioptechs) and 100,000-200,00 cells for experiments involving 8-well chamber (Lab-Tek) ...
-
No products found
because this supplier's products are not listed.
Suranjana Pal, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Mouse anti-RFP (1:200; Allele Biotech, catalog #ABP-MAB-RT008 ...
-
No products found
because this supplier's products are not listed.
Ly Porosk, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Peptide-based transfection reagent Reagent007 from Icosagen suitable for suspension cells ...
-
No products found
because this supplier's products are not listed.
Kyung-Jin Jang, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
Alpha Glutathione S-Transferase (α-GST): levels were quantified in human model effluent samples from the upper channel using an ELISA kit (DiaPharma). The assay was run following the vendor protocol using a standard curve ranging from 0-64 µg/L ...
-
No products found
because this supplier's products are not listed.
Mireia Rovira, et al.,
bioRxiv - Immunology 2022
Quote:
... Peptides were purified using SDB-RPS columns (Affinisep). Briefly ...
-
No products found
because this supplier's products are not listed.
Tommaso Montecchi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... SEB and SEE peptides (2μg/ml) (Toxin Technology) or 1% BSA for controls ...
-
No products found
because this supplier's products are not listed.
Martin F. Orth, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... monoclonal mouse anti-PD-1 antibody (1:80; 315M-96, MEDAC, Wedel, Germany), and monoclonal mouse anti-Ki-67 antibody (M7240 ...
-
No products found
because this supplier's products are not listed.
Soham Ghosh, et al.,
bioRxiv - Biophysics 2021
Quote:
... StageFlexer Type I Collagen treated membranes (FlexCell International Corp.) were used for the chondrocyte culture and stretching ...
-
No products found
because this supplier's products are not listed.
Anna Sloutskin, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... The same membrane was stripped (ST010, Gene Bio-Application) and re-blotted with mouse anti-Actin monoclonal antibodies (1:1000 in 3% BSA ...
-
No products found
because this supplier's products are not listed.
Alexandra Sneider, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... 177 cm2 25 kPa Collagen Type I Coated Plates (Matrigen), and 150 cm2 plastic tissue culture flasks (“plastic” ...
-
No products found
because this supplier's products are not listed.
Anne-Stéphanie Rueff, et al.,
bioRxiv - Microbiology 2023
Quote:
... bacteria were harvested at OD595nm of 0.1 and incubated with 1/1000 of Pneumococcus type 2 Rabbit antiserum (SSI Diagnostica, 16745) for 5 min on ice ...
-
No products found
because this supplier's products are not listed.
Lisa Pomeranz, et al.,
bioRxiv - Bioengineering 2023
Quote:
ELISA plates were coated with 1µg/mL human spleen ferritin (Lee Biosolutions, MO) in PBS overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Lene Clausen, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... the transformed strain was mated to the yeast gene deletion strain collection by automated pinning (RoToR, Singer Instruments, UK). Selection for diploids ...
-
No products found
because this supplier's products are not listed.
Swathi Kota, et al.,
bioRxiv - Microbiology 2020
Quote:
... The transformed colonies obtained for both wild type and ΔtopoIB were grown in TYG with and without G4 DNA stabilizing agent 50 nM NMM (Frontier Scientific) at 32°C ...
-
No products found
because this supplier's products are not listed.
Vera Vysochinskaya, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... or to 5 µL peptide/liposome complexes with siRNA and applied to a freshly cleaved mica (SPI Supplies, West Chester, PA, USA). The mixture was then incubated at room temperature for 1 minute ...
-
No products found
because this supplier's products are not listed.
Victoria E. Brings, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... the surface of the right hind paw was sterilized and a 5-mm incision was made through the skin starting 2 mm from the heel using a type 11 scalpel blade (McKesson, Richmond, VA). The flexor digitorum brevis muscle was pulled up to isolate ...
-
No products found
because this supplier's products are not listed.
Suk Woo Kang, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 1-cyclohexene-1-carboxylic acid (16a) and methyl-1-cyclohexene-1-carboxylate (17a) were provided by Enamine (Kiev, Ukraine). trans-myrtanol was purchased from abcr GmbH (Karlsruhe ...
-
No products found
because this supplier's products are not listed.
Zixuan Liu, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... Cell counting kit-8 (M4839, AbMole).
-
No products found
because this supplier's products are not listed.
Teodor E. Yordanov, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Sodium Hyaluronate (1-1.8MDa) (Lifecore Biomedical; HA15M-1), Hyaluronidase from Streptomyces hyalurolyticus (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Ricardo J. Ferreira, et al.,
bioRxiv - Microbiology 2021
Quote:
... coli gyrase supercoiling assay kit from Inspiralis (Norwich Research Park ...
-
No products found
because this supplier's products are not listed.
Manami Suzuki-Karasaki, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 1 μM OxiOrangeTM or 1 μM HydropTM (Goryo Chemicals, Sapporo, Japan) for 20 min ...
-
No products found
because this supplier's products are not listed.
Wenzhi Feng, et al.,
bioRxiv - Cell Biology 2021
Quote:
... polyclonal anti-Hexokinase 1 rabbit IgG (United States Biological, 169073, 1:10000), polyclonal anti-NDT80 rabbit IgG (1:10000) ...
-
No products found
because this supplier's products are not listed.
Giorgio Anselmi, et al.,
bioRxiv - Immunology 2019
Quote:
... 1% BSA (Apollo Scientific) and 2 mM EDTA (Life Technologies) ...
-
No products found
because this supplier's products are not listed.
Rudolf O. Schlechter, et al.,
bioRxiv - Microbiology 2023
Quote:
... gas permeability of 0.6 m3 m−2 day−1 and water loss of 1 g m−2 day−1; Brooks Life Sciences, UK), and incubated at 30°C with shaking ...
-
No products found
because this supplier's products are not listed.
Saaz Sakrikar, Amy Schmid,
bioRxiv - Genomics 2021
Quote:
... 1 µg/mL mevinolin (AG Scientific) was added to liquid medium and 2.5 µg/mL to solid media to maintain selective pressure on the plasmid.
-
No products found
because this supplier's products are not listed.
Ilaria Frasson, et al.,
bioRxiv - Microbiology 2023
Quote:
... MKI-1 (ChemBridge, US, Cat: 9335496), Sulfasalazine (MedChemExpress at MedChemTronica EU ...
-
No products found
because this supplier's products are not listed.
C Kimberly Tsui, et al.,
bioRxiv - Cell Biology 2023
Quote:
... CSA (EY Laboratories, BA-3201-1), and SLBR-H and SLBR-N (made in-house in the Mahal Lab).
-
No products found
because this supplier's products are not listed.
Alicia Ravens, et al.,
bioRxiv - Neuroscience 2024
Quote:
... on coverslips (No. 1, Bioscience Tools) coated overnight with 0.2 mg/mL poly-L-lysine (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Qi Qu, et al.,
bioRxiv - Physiology 2023
Quote:
... followed by covering with a drop of mineral oil (1:1 - Halocarbon oil 700:Halocarbon oil 27). Some 2 nl of 500 ng/μl gRNAs targeting the exon 3 of ktub (5’-CGCATTACGCGGGACAGGAA-3’ and 5’-CGGAGATCTCATCGCACGAGT-3’ ...
-
No products found
because this supplier's products are not listed.
Marcos Moreno-Aguilera, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... More than 90 million reads were obtained per sample, which were aligned to the mm10 mouse genome using HISAT2 (Kim et al, 2015) in the Galaxy platform (Boekel et al, 2015). Assignment to transcriptional units ...
-
No products found
because this supplier's products are not listed.
Syed Moiz Ahmed, et al.,
bioRxiv - Cancer Biology 2019
Quote:
Endogenous TOP1cc were detected by Human Topoisomerase ICE kit (Topogen, TG1020-0) following the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Linglei Jiang, et al.,
bioRxiv - Immunology 2022
Quote:
... IgA (1:250, Brookwood Biomedical, AL, USA) or IgM (1:250 ...
-
No products found
because this supplier's products are not listed.
Antje Neeb, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... panBAG-1 (human, rabbit monoclonal, RM356, RevMAb), panBAG-1 (mouse ...
-
No products found
because this supplier's products are not listed.
P Whyte-Fagundes, et al.,
bioRxiv - Neuroscience 2023
Quote:
... AA43279 (Focus biomolecules, CAS: 354812-16-1), Chlorzoxazone (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Rémi Veneziano, et al.,
bioRxiv - Immunology 2020
Quote:
... PEG3500 (#A4010-1/MAL-PEG3500-MAL) and PEG2000 (#A4010-1/MAL-PEG2000-MAL) bismaleimide were purchased from JenKem Technology.
-
No products found
because this supplier's products are not listed.
Sepiedeh Keshavarzi, et al.,
bioRxiv - Neuroscience 2021
Quote:
... submerged in 1 % Tergazyme (in distilled water, Alconox) for at least an hour ...
-
No products found
because this supplier's products are not listed.
Marc Faber, et al.,
bioRxiv - Genomics 2020
Quote:
... bryozoan total RNA was treated with a PowerClean Pro RNA Clean-up kit (Cambio) to remove free and nucleic acid-bound PCR inhibiting substances ...
-
No products found
because this supplier's products are not listed.
Maggie R. Wagner, et al.,
bioRxiv - Plant Biology 2020
Quote:
... We used the Synergy 2.0 Plant DNA Extraction Kit (OPS Diagnostics, Lebanon, NJ, USA) to purify DNA ...
-
No products found
because this supplier's products are not listed.
Joseph I Aubee, et al.,
bioRxiv - Microbiology 2024
Quote:
... All PCR reactions were purified using The Column-PureTM Clean-Up Kit (Lamda Biotech), according to the manufacturer’s instructions (Lamda Biotech).
-
Calcitonin gene-related peptide is a member of the calcitonin family of peptides consisting of...
Cat# BAT-013603,
Inquire
Ask
Ana C. Puhl, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Pyronaridine tetraphosphate [4-[(7-Chloro-2-methoxybenzo[b][1,5]naphthyridin-10-yl)amino]-2,6-bis(1-pyrrolidinylmethyl)phenol phosphate (1:4)] (12) was purchased from BOC Sciences (Shirley NY). The purity of this compound was greater than 95% ...
-
No products found
because this supplier's products are not listed.
Clovis S Palmer, et al.,
bioRxiv - Immunology 2023
Quote:
... and samples oxidized with 1% Periodic Acid (Poly Scientific) for 10 minutes ...
-
No products found
because this supplier's products are not listed.
Esther W. Lim, et al.,
bioRxiv - Biochemistry 2021
Quote:
... were extracted from 10 µL of plasma with 750 µL of ice cold 1:1 methanol/water solution and 500 µL of ice cold chloroform with inclusion of EquiSLASH (Avanti, Croda International Plc, 330731), C15 Glucosyl(β ...
-
No products found
because this supplier's products are not listed.
Corinna Probst, et al.,
bioRxiv - Microbiology 2022
Quote:
... Pieces of upper and lower leaf sides were mounted onto metal stubs with double-sided sticky tape and coated with gold: palladium (1:1) in a Polaron SC 7640 (Quorum Technologies, Newhaven, UK) automated sputter coater ...
-
No products found
because this supplier's products are not listed.
Catherine Hume, et al.,
bioRxiv - Animal Behavior and Cognition 2022
Quote:
... 11-OH-THC and THC-COOH (at a known concentration of 10 ng/ml in 1:1 methanol and water; Cerilliant, Round Rock, TX, USA). Then samples were sonicated for 20-minutes to precipitate proteins ...
-
No products found
because this supplier's products are not listed.
Jenny Vo, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... The cells are lysed in a 2ml Eppendorf tube containing 1mL 0.5mm zirconia beads by vortexing for six cycles of 1 minute vortexing with 1 minute pauses using the Turbomix attachment on a Vortex Genie 2 (Scientific Industries Inc SKU: SI-0564) that had been pre-run at max speed for 1 minute preceding the vortexing to ensure consistent machine performance in the cold ...
-
No products found
because this supplier's products are not listed.
Taka A. Tsunoyama, et al.,
bioRxiv - Cell Biology 2021
Quote:
... with a constant voltage of 100 V for 1 h (Mini Protean Tetra Cell). The immuno-detection was performed by a SNAP i.d ...