-
No products found
because this supplier's products are not listed.
Stefania Zuppone, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... an in-house sandwich enzyme linked immunoassay (ELISA) kit (HansaBioMed Life Sciences), following the manufacturer’s protocol provided with the kit ...
-
No products found
because this supplier's products are not listed.
Ho-Shiang Huang, Chan-Jung Liu,
bioRxiv - Biochemistry 2021
Quote:
Commercial kits were used to determine the urine level of NGAL (NGAL ELISA Kit, BioPorto Diagnostics A/S, Copenhagen, Denmark) and the urine levels of stone-induced renal tubular damage markers ...
-
No products found
because this supplier's products are not listed.
Brandon A. Berryhill, et al.,
bioRxiv - Microbiology 2023
Quote:
... coli O antigen specific antisera was obtained from SSI Diagnostica and used as detailed in their protocol for the slide agglutination assay ...
-
No products found
because this supplier's products are not listed.
Julia Bitencourt, et al.,
bioRxiv - Immunology 2021
Quote:
... The antigens used were purified protein derivative (PPD) from M.tb (Statens Serum Institut (SSI), Denmark ...
-
No products found
because this supplier's products are not listed.
Yuichi Shichino, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... and then incubated with 150 μl of FLAG elution buffer (FLAG wash buffer 2 with 1 mg/ml 3×FLAG peptide [Protein Ark, GEN-3XFLAG-25]) overnight ...
-
No products found
because this supplier's products are not listed.
Robin S. Lindsay, et al.,
bioRxiv - Immunology 2021
Quote:
... 1µg/ml of 8.3 peptide (KYNKANVEL) (Chi Scientific), or 100ng/ml of OT-I peptide (SIINFEKL ...
-
No products found
because this supplier's products are not listed.
Jamie L. Null, et al.,
bioRxiv - Cancer Biology 2022
Quote:
Antigen-retrieval was performed on a tissue microarray of paraffin-embedded breast tumor cores (US Biomax BR20829) at 95° C for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Daisuke Shimura, et al.,
bioRxiv - Cell Biology 2021
Quote:
... using Mouse Mitochondrial DNA Copy Number Assay kit (Detroit R&D, Detroit, MI) for the samples from the mouse heart or Human Mitochondrial DNA Monitoring Primer Set (TaKaRa Bio ...
-
No products found
because this supplier's products are not listed.
Francesco Caiazza, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... and peptides desalted with C18 Desalting Tips (Rainin, Oakland, CA, USA), lyophilized ...
-
No products found
because this supplier's products are not listed.
Lisa Pomeranz, et al.,
bioRxiv - Bioengineering 2023
Quote:
ELISA plates were coated with 1µg/mL human spleen ferritin (Lee Biosolutions, MO) in PBS overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Gaia Calamera, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... 2 mM EDTA and lysed using Solobuffer cell lysis kit (Fabgennix, Frisco, TX 75033, US). Measurements of ATP in the samples were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Nora Schmidt, et al.,
bioRxiv - Microbiology 2020
Quote:
... and quantified with the LightMix Assay SARS-CoV-2 RdRP RTqPCR assay kit (TIB MOLBIOL, Germany) and the RNA Process Control kit (Roche) ...
-
No products found
because this supplier's products are not listed.
John H. Klich, et al.,
bioRxiv - Bioengineering 2022
Quote:
... RAFT CTA 2-cyano-2-propyl dodecyl trithiocarbonate (2-CPDT; >97%; Strem Chemicals) was used as received ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Susan Klaeger, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Peptides were loaded onto an analytical column (25-30cm, 1.9um C18 (Dr. Maisch HPLC GmbH), packed in-house PicoFrit 75 μm inner diameter ...
-
No products found
because this supplier's products are not listed.
Susan Paton, et al.,
bioRxiv - Microbiology 2021
Quote:
... RT-PCR was performed using the VIASURE SARS-CoV-2 Real Time PCR Detection Kit (Viasure; CerTest Biotec, Zaragoza, Spain), following the methods provided ...
-
No products found
because this supplier's products are not listed.
J. Aaron Crapster, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... anti-ZP3R/mouse sp56 (7C5) (QED Bioscience, 55101, lot 051614-120816, mouse mAb); anti-IZUMO1 (125 ...
-
No products found
because this supplier's products are not listed.
Cheng Wu, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Microglass pipettes filled with 1 μl Aβ-555 peptide solution were connected to a microinjection system (BASi, USA). Aβ40-555 were used among hypertension groups and Aβ42 555 were used among APP/PS1 groups ...
-
No products found
because this supplier's products are not listed.
Kristoffer Krogerus, Nils Rettberg, Brian Gibson,
bioRxiv - Microbiology 2022
Quote:
... after which spores from the different parental strains were dissected and placed next to each other on YPD agar plates (1 % yeast extract, 2 % peptone, 2 % glucose, and 2 % agar) using a micromanipulator (Singer Instruments, UK). The plates were incubated at 25 °C for 3 days ...
-
No products found
because this supplier's products are not listed.
Daniela Fraccarollo, et al.,
bioRxiv - Immunology 2021
Quote:
... Serum samples were screened for CMV-specific IgG antibodies with the CMV-IgG-ELISA PKS Medac enzyme immunoassay (115-Q-PKS; Medac Diagnostika), using a cut-off value of >0.55 AU/mL for defining seropositivity according to manufacturer’s guidelines ...
-
A DNA sequence encoding the extracellular domain of mouse Cd33 (Met 1 - Glu 240) (FITC...
Cat# Cd33-6889MF,
50ug , USD $1298
Ask
Yan Qi, et al.,
bioRxiv - Molecular Biology 2024
Quote:
... the presence of anti- Ad and anti-hemagglutinin antibodies was measured by ELISA against a purified Ad6 virus preparation (Greffex, Inc.) and a recombinant hemagglutinin protein (Creative Biomart). In the first case ...
-
No products found
because this supplier's products are not listed.
Sandeep Adem, et al.,
bioRxiv - Bioengineering 2020
Quote:
Biotin-PEG36-Thr-Phe-Ser-Tyr-Nle-Arg-Trp-Pro-PEG12-Cys (known as peptide) was synthesized by CPC Scientific and Biotin-PEG-SH (known as linker) was purchased from NANOCS. Peptide (2 µM ...
-
No products found
because this supplier's products are not listed.
Andres Tapia del Fierro, et al.,
bioRxiv - Molecular Biology 2021
Quote:
Genomic DNA (400 ng) from mouse tail was bisulphite converted with the EZ DNA Methylation-Lightning kit (Zymo Research; BaseClear Lab Products, Leiden, the Netherlands) following the instructions of the manufacturer ...
-
No products found
because this supplier's products are not listed.
Nisha Dhanushkodi, et al.,
bioRxiv - Immunology 2022
Quote:
... HSV-2 DNA copy number was determined using purified HSV-2 DNA (Advanced Biotechnologies, Columbia, MD) and based on a standard curve of the CT values ...
-
No products found
because this supplier's products are not listed.
Jun Li, et al.,
bioRxiv - Bioengineering 2023
Quote:
YS5 was first conjugated with the bi-functional chelator 2-(4-isothiocyanotobenzyl)-1,4,7,10-tetraaza-1,4,7,10-tetra-(2-carbamoylmethyl)-cyclododecane (TCMC; Macrocyclics, Plano, TX) at the molar ratio of TCMC/YS5 at 10:1 ...
-
No products found
because this supplier's products are not listed.
Etai Sapoznik, et al.,
bioRxiv - Biophysics 2020
Quote:
... #1.5 coverslips (0420-0323-2, Bioptechs) were washed at room temperature in solution consisting of 1:1 (vol/vol ...
-
No products found
because this supplier's products are not listed.
Suranjana Pal, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Mouse anti-RFP (1:200; Allele Biotech, catalog #ABP-MAB-RT008 ...
-
No products found
because this supplier's products are not listed.
Kiyohiko Andoh, Asami Nishimori, Yuichi Matsuura,
bioRxiv - Microbiology 2023
Quote:
... mouse anti-BLV p24 MAb (VMRD: BLV3), mouse anti-His tag MAb (MBL ...
-
No products found
because this supplier's products are not listed.
Anuli C. Uzozie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
Dried samples were resuspended in 0.1% TFA in 80% acetonitrile and phosphorylated peptides were purified by immobilized metal affinity chromatography (IMAC) using Fe-NTA MagBeads (Cube Biotech, Monheim, Germany). Sample solution was added to beads washed with 0.1% TFA in 80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Didier Hodzic, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Multi-Trol mouse serum controls (Drew Scientific, Inc.) were used for calibration of the Hemavet HV950 ...
-
No products found
because this supplier's products are not listed.
Tim Vangansewinkel, et al.,
bioRxiv - Neuroscience 2022
Quote:
... A mouse intrathecal catheter (Alzet®, DURECT Corp.) was carefully inserted via this opening into the intrathecal space at the midline ...
-
No products found
because this supplier's products are not listed.
JM Sweeter, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Mouse AECs were stained for Muc5b by mouse monoclonal antibody 3AE (27) and rabbit antibody Scgb1a1 (Seven Hills BioReagents WRAB-3950).
-
No products found
because this supplier's products are not listed.
Marta Lopez-Nieto Jordana, et al.,
bioRxiv - Cell Biology 2023
Quote:
... expression levels of GADD34 in 2 control and 5 GADD34 KO single cell clones in response to 2 µM thapsigargin (Biotrend) treatment for 3 h was assessed by Western blotting ...
-
No products found
because this supplier's products are not listed.
Melika Shahhosseini, et al.,
bioRxiv - Bioengineering 2022
Quote:
... supplemented with 2% heat-inactivated FBS (Atlas Biologicals), and 1mM MgCl2 ...
-
No products found
because this supplier's products are not listed.
Hussein Al-Akhrass, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... and MK-2206 (Adooq Bioscience, A10003, [2] µM) were used for the indicated time points.
-
No products found
because this supplier's products are not listed.
Sanket S. Ponia, et al.,
bioRxiv - Microbiology 2021
Quote:
... mouse anti ZIKV Envelope (#BF-1176-56, BioFront Technologies) and chicken antibody to SENV (#ab33988 ...
-
No products found
because this supplier's products are not listed.
M.M. Joglekar, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... VCAN (1:200, Mouse Anti-Versican Antibody 2B1, Seikagaku), and ELN (1:400 ...
-
No products found
because this supplier's products are not listed.
Sangam Kandel, et al.,
bioRxiv - Genomics 2023
Quote:
... Samples were tested for the SARS-CoV-2 using the Aptima® SARS-CoV-2 (Panther® System, Hologic, San Diego, CA) nucleic acid amplification assay ...
-
No products found
because this supplier's products are not listed.
Francisco J. Calero-Cuenca, et al.,
bioRxiv - Cell Biology 2020
Quote:
... mouse anti-Myc 1:200 (Alfagene/Life Technologies #13-2500). The secondary antibodies (1:600 dilution ...
-
No products found
because this supplier's products are not listed.
Chen Jiang, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Primary mouse keratinocytes were kept in culture medium (CnT-07; Cellntec) at 37°C and 5% CO2 ...
-
No products found
because this supplier's products are not listed.
Kristen A. Gaffney, et al.,
bioRxiv - Biophysics 2021
Quote:
... iodoacetyl-7-nitrobenz-2-oxa-1,3-diazol (IA-NBD, Setareh Biotech) (42) ...
-
No products found
because this supplier's products are not listed.
Hiroshi Yamaguchi, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Methylated gold nanoparticles (final 1:2 dilution; CGM2K-15-25, Cytodiagnostics) were added as fiducial markers ...
-
No products found
because this supplier's products are not listed.
Joe Chin-Hun Kuo, et al.,
bioRxiv - Bioengineering 2024
Quote:
... prepared with a 2 mm diameter silicon spacer well (Grace Biolabs) that acted as the gelation chamber in downstream ExM processing.
-
No products found
because this supplier's products are not listed.
Miho Matsuda, Chih-Wen Chu, Sergei Y. Sokol,
bioRxiv - Cell Biology 2021
Quote:
... mouse anti-DYKDDDDK mAb clone 2H8 (Cosmo Bio USA, #KAL- K0602, 1:1000) and mouse anti-GFP mAb clone B2 (Santa Cruz Biotechnology ...
-
No products found
because this supplier's products are not listed.
Ting Pan, et al.,
bioRxiv - Plant Biology 2021
Quote:
... Seeds were surface-sterilized and sowed on MS/2 medium (PhytoTechnology laboratories) (1% sucrose pH 5.7 ...
-
No products found
because this supplier's products are not listed.
Jonna Heldrich, et al.,
bioRxiv - Genomics 2020
Quote:
... Samples were immunoprecipitated with 2 μL of either anti-Top2 (TopoGEN, #TG2014), anti-MYC 9E11 (Abcam ...
-
No products found
because this supplier's products are not listed.
Xiangling Meng, et al.,
bioRxiv - Neuroscience 2022
Quote:
... hiPS cells (2 × 106 cells) dissociated with accutase (Innovative Cell Technologies, AT104) were electroporated using the P3 Primary Cell 4D-NucleofectorTMX Kit L (Lonza ...
-
No products found
because this supplier's products are not listed.
Robert S. Kellar, et al.,
bioRxiv - Bioengineering 2020
Quote:
... The proteins were dissolved into 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP, Oakwood Chemical, Estill, SC). The biomimetic WHDs were prepared using a ratio of 9:1 collagen to rhTE ...
-
No products found
because this supplier's products are not listed.
Adrian Kendal, et al.,
bioRxiv - Cell Biology 2021
Quote:
... a 7 % w/v polymer solution of PDO (Riverpoint Medical, Portland, Oregon , USA) in 1,1,1,3,3,3-Hexafluoro- 2-propanol (HFIP, Halocarbon Product Corporation ...
-
No products found
because this supplier's products are not listed.
Sing Teng Chua, et al.,
bioRxiv - Plant Biology 2023
Quote:
... sublimated at -90°C (2 minutes) and finally sputter coated with platinum (10 nm; Quorum Technologies Q150T ES).