-
No products found
because this supplier's products are not listed.
Joydeb Sinha, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Harvested virus was 0.4μM filtered (Celltreat 229749) and concentrated by centrifugation using a 100kdA cut-off PES protein concentrator (Pierce 88533 ...
-
No products found
because this supplier's products are not listed.
Yusha Sun, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... mouse anti-TPH2 (Thomas Scientific, AMAb91108), rabbit anti-TH (Novus Biologicals ...
-
No products found
because this supplier's products are not listed.
Shiho Tanaka, et al.,
bioRxiv - Immunology 2021
Quote:
... Complex was mixed with F-octylmaltoside solution (Anatrace) to a final concentration of 0.02% w/v and then 3 µL were immediately applied to a 300 mesh ...
-
No products found
because this supplier's products are not listed.
Taeyong Kwon, et al.,
bioRxiv - Microbiology 2022
Quote:
... The same amount of the virus was mixed with 45 µL of human saliva (Lee Biosolutions) or medium and transferred into a 2 mL tube or onto stainless steel in the 12-well plate ...
-
No products found
because this supplier's products are not listed.
Michele N. Dill, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with a mouse monoclonal anti-GAPDH loading control (Arigo biolaboratories ARG10112, 1:5000 dilution) overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Janhavi Prasad Natekar, et al.,
bioRxiv - Microbiology 2022
Quote:
Tissues harvested from virus-inoculated animals were weighed and homogenized in a bullet blender (Next Advance, Averill Park, NY, USA) using stainless steel or zirconium beads ...
-
No products found
because this supplier's products are not listed.
Erik Aznauryan, et al.,
bioRxiv - Genomics 2021
Quote:
... Primary fibroblasts were cultured for up to 25 days in Prime Fibroblast media (CELLNTEC, CnT-PR-F). Cells were passaged at 70% confluency using Accutase (CELLNTEC ...
-
Recombinant Mouse IMPDH2 full length or partial length protein was expressed.
Cat# IMPDH2-8199M,
20ug , USD $798
Ask
Yan Qi, et al.,
bioRxiv - Molecular Biology 2024
Quote:
... the presence of anti- Ad and anti-hemagglutinin antibodies was measured by ELISA against a purified Ad6 virus preparation (Greffex, Inc.) and a recombinant hemagglutinin protein (Creative Biomart). In the first case ...
-
No products found
because this supplier's products are not listed.
Marta Rossi, Davide De Battisti, Jeremy E. Niven,
bioRxiv - Physiology 2019
Quote:
... the secreted droplet was removed at intervals of 30 minutes (Fig 1E,F) using a P10 pipette (Gilson Scientific UK ...
-
No products found
because this supplier's products are not listed.
Ben Nicholas, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 2 mg of anti-MHC-I mouse monoclonal antibodies (W6/32) covalently conjugated to Protein A sepharose (Repligen) using DMP as previously described [42,43] were added to the clarified supernatants and incubated with constant agitation for 2 h at 4°C ...
-
No products found
because this supplier's products are not listed.
Daniela Corrales, et al.,
bioRxiv - Microbiology 2023
Quote:
... mk+) supE44 thi-1 recA1 gyrA96 relA1 lac[F′ proA+B+ lacIq ΔlacZM15:Tn10(TcR)]) chemically competent cells (NZYtech) were used as an intermediate host for cloning purposes and they were grow in LB medium at 37 °C under agitation ...
-
No products found
because this supplier's products are not listed.
John R. Cumbers, Lynn J. Rothschild,
bioRxiv - Microbiology 2022
Quote:
... The unwashed membrane was incubated in mouse anti-thymine dimer primary antibody (#MC-062, Kamiya Biomedical, Seattle, WA, USA) at a 1:3000 dilution in PBS-T buffer for two hours at room temperature ...
-
No products found
because this supplier's products are not listed.
Magen E. Francis, et al.,
bioRxiv - Microbiology 2021
Quote:
... to confirm stability of the SARS-CoV-2 virus after culture in vDMEM (DMEM (Dulbecco’s Modified Eagle Medium) (Wisent Bioproducts (Cat # 319-005-CL)) ...
-
No products found
because this supplier's products are not listed.
Christopher R. Friesen, et al.,
bioRxiv - Evolutionary Biology 2019
Quote:
... semen was collected from the female’s cloaca by pulling the ejaculate into a 1 mL syringe (Olsson, 2001) preloaded with 100 µL Hams F-10 medium (Cat # 99175, Irvine Scientific, Santa Ana ...
-
No products found
because this supplier's products are not listed.
Monika Chodasiewicz, et al.,
bioRxiv - Plant Biology 2022
Quote:
... Thermal unfolding of G-actin (2 μM) and F-actin (2 μM) was performed with the Tycho NT.6 (Nanotemper, Munich, Germany) according to the manufacturer’s instructions in G-buffer (5 mM Tris-HCl ...
-
No products found
because this supplier's products are not listed.
Alisa Fox, et al.,
bioRxiv - Immunology 2021
Quote:
... cells were washed and incubated in Accutase cell detachment solution for 10 min at room temperature to gently remove any surface-bound virus while preserving epitopes for flow cytometry analysis (Innovative Cell Technologies; as described in (39)) ...
-
No products found
because this supplier's products are not listed.
Deanna M. Marchionini, et al.,
bioRxiv - Neuroscience 2022
Quote:
... blocked in 10% normal goat serum/ 10% mouse- on-mouse blocking (ScyTek Laborities, No. MTM015)/ TBS ...
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
Tim Vangansewinkel, et al.,
bioRxiv - Neuroscience 2022
Quote:
... A mouse intrathecal catheter (Alzet®, DURECT Corp.) was carefully inserted via this opening into the intrathecal space at the midline ...
-
No products found
because this supplier's products are not listed.
Stephen D. Glasgow, et al.,
bioRxiv - Neuroscience 2019
Quote:
Mouse brains were processed (FD Rapid GolgiStain Kit; FD Neurotechnologies) and cut into 100 μm sections with a cryostat ...
-
No products found
because this supplier's products are not listed.
Malachy Guzman, et al.,
bioRxiv - Genetics 2023
Quote:
... Each mouse was weighed with a analytical laboratory scale (Ohaus) immediately prior to recording ...
-
No products found
because this supplier's products are not listed.
Drew A. Gillett, et al.,
bioRxiv - Immunology 2024
Quote:
Recombinant mouse GPNMB ECD (Aviscera Biosciences, product code 00719-03-10) was diluted in pre-warmed complete RPMI to a final concentration of 0.5ug/ml and 1.0ug/mL and was applied for 4 hours prior to lipopolysaccharide (LPS ...
-
No products found
because this supplier's products are not listed.
Marvin J. Sandoval, et al.,
bioRxiv - Immunology 2021
Quote:
... and then incubated with mouse IFNλ2/3 DNA probes (Advanced Cell Technologies), followed by a series of RNA Scope adaptor probes ...
-
No products found
because this supplier's products are not listed.
Yukiko Yamaguchi, et al.,
bioRxiv - Immunology 2022
Quote:
Collected mouse tissue was fixed in 4% paraformaldehyde (4% PFA, Boston BioProducts) and stored in 70% ethanol until processed further ...
-
No products found
because this supplier's products are not listed.
Alexis M. Crockett, et al.,
bioRxiv - Neuroscience 2019
Quote:
Mouse anterior cortex was thawed and sonicated in RIPA Lysis buffer (Amresco) on ice using an Ultrasonic Homogenizer (Biologics Inc.) ...
-
No products found
because this supplier's products are not listed.
Mizuho Nosaka, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... tPA (Mouse tPA ELISA Kit, PA92, Oxford Biomedical Research, Rochester Hills, MI), uPA (Active mouse uPA Functional Assay Kit ...
-
No products found
because this supplier's products are not listed.
Laura von Schledorn, et al.,
bioRxiv - Bioengineering 2023
Quote:
... cells were detached with Accutase™ and stained with anti-CXCR4, anti-cKIT and anti-EpCAM in FACS Buffer (PBS w/o, 1.0% FCS (Pan Biotech), 1 mM EDTA ...
-
No products found
because this supplier's products are not listed.
Sandra Grund-Gröschke, et al.,
bioRxiv - Cancer Biology 2019
Quote:
Mouse dorsal skin was homogenized with the Ultra-Turrax® (IKA, Staufen, Germany) in PBS supplemented with protease inhibitor (Sigma ...
-
No products found
because this supplier's products are not listed.
Daisuke Shimura, et al.,
bioRxiv - Cell Biology 2021
Quote:
... using Mouse Mitochondrial DNA Copy Number Assay kit (Detroit R&D, Detroit, MI) for the samples from the mouse heart or Human Mitochondrial DNA Monitoring Primer Set (TaKaRa Bio ...
-
No products found
because this supplier's products are not listed.
Amrita Srivastava, et al.,
bioRxiv - Immunology 2020
Quote:
Mouse ankles were fixed for 24 hours in buffered zinc formalin (Anatech Ltd), decalcified for 9 days in Shandon TBD-2 ...
-
No products found
because this supplier's products are not listed.
Juan Yang, et al.,
bioRxiv - Neuroscience 2023
Quote:
... P7 - P75 mouse brains were coronal sectioned using Compresstome (Precisionary Instruments LLC, NC) to a thickness of 30 - 50 μm.
-
No products found
because this supplier's products are not listed.
VP O’Brien, et al.,
bioRxiv - Microbiology 2022
Quote:
... Slides with mouse stomach tissue sections were deparaffinized in Histo-Clear solution (National Diagnostics) and rehydrated with isopropanol ...
-
No products found
because this supplier's products are not listed.
Swayam Prakash Srivastava, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Urine albumin levels were assayed using a Mouse Albumin ELISA Kit (Exocell, Philadelphia, PA).
-
No products found
because this supplier's products are not listed.
Elin Palm, et al.,
bioRxiv - Microbiology 2023
Quote:
... MAB227P Monoclonal antibody to Norovirus (Mouse IgG2a κ, Clone 2002-G5, Maine Biotechnology Services), rabbit anti-Alexa Fluor 488-conjugated polyclonal IgG (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Nicole Stantial, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... or anti-Top2 (TopoGen, #TG2014) antibody ...
-
No products found
because this supplier's products are not listed.
Guang Lin, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Rabbit anti-GlcCer (Glycobiotech; RAS_0010); Mouse anti-ATP5a (Abcam ...
-
No products found
because this supplier's products are not listed.
Sarah K. Williams Avram, et al.,
bioRxiv - Neuroscience 2019
Quote:
... All cages were maintained on high-density ventilated racks (Super Mouse 750, Lab Products Inc.). Mice were maintained on a 12-h light cycle (lights off at 1500h ...
-
No products found
because this supplier's products are not listed.
Hirad Daneshpour, et al.,
bioRxiv - Systems Biology 2021
Quote:
... We calibrated the FSC and SSC gates to detect only mouse ES cells (FSC-PMT = 231 V ...
-
No products found
because this supplier's products are not listed.
Jian Cui, et al.,
bioRxiv - Immunology 2023
Quote:
... 25 μL of HBSA containing 10 nM mouse FVIIa (Enzyme Research Laboratories, South Bend, IN), 300 nM human FX (Enzyme Research Laboratories ...
-
No products found
because this supplier's products are not listed.
Donald Iain MacDonald, et al.,
bioRxiv - Neuroscience 2023
Quote:
... we produced a mouse Tacr1 DNA construct by gene synthesis (Epoch Life Science, GS66243-3). Tacr1 was subcloned along with a synthesized human G-protein α-subunit gene Gα15 and GCaMP6s it into the lentiviral plasmid backbone pLV-CMV-PGK-Hyg (Cellomics Technology ...
-
No products found
because this supplier's products are not listed.
George R. Heaton, et al.,
bioRxiv - Molecular Biology 2020
Quote:
Frozen adult (1 year) mouse Brains and Kidneys were homogenised using a 1mL Tissue Grinder (Wheaton) in 20mM HEPES tissue lysis buffer with protease inhibitors and centrifuged at 1,000g for 10 minutes ...
-
No products found
because this supplier's products are not listed.
Liangxi Wang, et al.,
bioRxiv - Genomics 2022
Quote:
... Cells were then treated with 10 ng/mL recombinant mouse TNFα (Cell Applications, cat# RP2031-20) for 45 min in basal Endothelial Cell Growth Media MV2 (PromoCell ...
-
No products found
because this supplier's products are not listed.
Ilaria Russo, et al.,
bioRxiv - Physiology 2024
Quote:
Total RNA was extracted from mouse RV tissue using the Tissue RNA Purification Kit (Norgen Biotek) and motorized tissue grinder (Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Tsunaki Hongu, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... mice were intravenously injected with clodronate-liposome (100-150 μl per mouse, every other day, Liposoma BV). Short-term experiments were performed by treatment with clodronate-liposome on day 14 ...
-
No products found
because this supplier's products are not listed.
Elangovan Boobalan, et al.,
bioRxiv - Developmental Biology 2022
Quote:
Mouse embryos at E18.5 were stained with Alcian Blue 8GX (A0298, Bio Basic Canada, Inc. Markham ON, Canada) and Alizarin Red S (SC-205998 ...
-
No products found
because this supplier's products are not listed.
Xue-Wei Wang, et al.,
bioRxiv - Neuroscience 2019
Quote:
... the right optic nerve of the mouse was exposed intraorbitally and crushed with Dumont #5 fine forceps (Fine Science Tools) for 5 s at approximately 1 mm behind the optic disc ...
-
No products found
because this supplier's products are not listed.
Pabitra K. Parua, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... rabbit anti-Spt5-pSer666 and −pThr806 (21st Century Biochemicals) previously described 56 ...
-
No products found
because this supplier's products are not listed.
Kim S. Friedmann, et al.,
bioRxiv - Immunology 2020
Quote:
... APC-labelled anti-MART-1 (ELAGIGILTV) dextramers (Immudex, 1:5), APC-labelled A*0201 dextramer negative control (Immudex ...
-
No products found
because this supplier's products are not listed.
Kathleen M.E. Gallagher, et al.,
bioRxiv - Immunology 2021
Quote:
A qualitative ELISA for Human Anti-IgG/A/M SARS-CoV-2 ELISA (The Binding Site) was performed using donor serum per manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Shiaki A. Minami, et al.,
bioRxiv - Bioengineering 2021
Quote:
Indirect ELISAs were performed to assess the sensitivities of CHO-expressed proteins to a human anti-Spike monoclonal antibody CR3022 (NR-52392, BEI Resources, RRID:AB_2848080) and a rabbit anti-Spike polyclonal antibody (PAb, eEnzyme, SCV2-S-100 ...