-
No products found
because this supplier's products are not listed.
MegAnne Casey, et al.,
bioRxiv - Neuroscience 2023
Quote:
... using the primary antibodies rabbit anti-cleaved caspase-3 (Trevigen) and chicken anti-Atp7a (Sigma) ...
-
No products found
because this supplier's products are not listed.
Natalie Warsinger-Pepe, et al.,
bioRxiv - Synthetic Biology 2022
Quote:
... The PRE repeats of PRExpress were removed using Kpn-I and Nhe-I and purified using Zymoclean Gel DNA Recovery Kit (Genesee Scientific #11-301). This fragment was subcloned with the above PCR fragment using Gibson enzymatic assembly (Gibson et al ...
-
No products found
because this supplier's products are not listed.
Alexis S. Zajicek, et al.,
bioRxiv - Neuroscience 2021
Quote:
... blots were stripped between probes with Membrane Stripping Buffer-3 (Boston BioProducts). Signals were detected using SuperSignal West Femto Maximum Sensitivity Substrate Kit (Pierce ...
-
No products found
because this supplier's products are not listed.
Aracely Acevedo, et al.,
bioRxiv - Biochemistry 2023
Quote:
... or leucine (Sciencell Laboratories) and supplemented with 10 mM glucose ...
-
No products found
because this supplier's products are not listed.
Shajo Kunnath-Velayudhan, et al.,
bioRxiv - Immunology 2021
Quote:
... immunoglobulin-depleted FBS (10%; Atlanta Biologicals), β-mercaptoethanol (Life Technologies) ...
-
No products found
because this supplier's products are not listed.
Miglė Kišonaitė, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Boc-L-R-R-AMC (trypsin-like activity) and Z-L-L-E-AMC (caspase-like activity) (Boston Biochem). The proteasome samples were incubated with 50 μM AMC-peptide in the respective purification buffers (standard or the exogenous nucleotide depleted buffer ...
-
Cat# AG148-10,
USD $145.0/10.0ml
Ask
Tri Komala Sari, et al.,
bioRxiv - Microbiology 2019
Quote:
... and H1817 (domain VI) were from Virusys. Anti-gB monoclonal antibodies DL16 (oligomer-specific ...
-
No products found
because this supplier's products are not listed.
Edward I. Patterson, et al.,
bioRxiv - Microbiology 2020
Quote:
... and a domain linker ((G4S)4) between the variable heavy (VH) and variable light (VL) domains (Integrative DNA Technologies) (Figure 1B) ...
-
This product is a made-to-order Human LRIG3 membrane protein expressed in HEK293. The protein is...
Cat# MPC3643K,
1.0 case, Inquiry
Ask
Mohammad Barghouth, et al.,
bioRxiv - Physiology 2022
Quote:
Anti-insulin VHH Single Domain Antibody tagged with biotin was purchased from Creative Biolabs (Cat# NAB-1554-VHH); guinea pig primary IgG anti-insulin antibody from EuroDiagnostica (B65-1) ...
-
No products found
because this supplier's products are not listed.
Dipsikha Biswas, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 120 uL of internal standard (ISTD; 4 ug/ml in H2O containing leucine-d3 (CDN Isotopes, D-1973) and 0.8 ng/uL in H2O containing sodium-2-Keto-3-methyl-d3-butyrate-3,4,4,4d4 (KIVd7 ...
-
No products found
because this supplier's products are not listed.
Olga M. Mazina, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... 3 µg of normal mouse IgG (protein A purified, Innovative Research) was incubated with 500 µl of diluted WCE (750 µg ...
-
No products found
because this supplier's products are not listed.
Xusheng Qiu, et al.,
bioRxiv - Microbiology 2020
Quote:
... Mouse anti-glyceraldehyde-3-phosphate dehydrogenase (GAPDH) monoclonal antibody was purchased from Meridian Life Science. Horseradish peroxidase (HRP)-conjugated anti-human ...
-
No products found
because this supplier's products are not listed.
Md. Golam Kibria, et al.,
bioRxiv - Biophysics 2022
Quote:
... 200 μL of protein samples in a 3-mm optical path length quartz cuvette (T-507, TOSOH, Japan) was used for the measurements ...
-
No products found
because this supplier's products are not listed.
Laura Medina-Puche, et al.,
bioRxiv - Plant Biology 2019
Quote:
... GFP-fused proteins were detected using mouse monoclonal anti-GFP antibody (1:5,000; Abiocode).
-
No products found
because this supplier's products are not listed.
Brahmaiah Pendyala, et al.,
bioRxiv - Microbiology 2020
Quote:
... assay (Catalog #79955) and papain-like protease (SARS-CoV-2) assay kit: protease activity (Catalog #79995) were purchased from BPS Bioscience (San Diego, CA).
-
No products found
because this supplier's products are not listed.
Renée M. van der Sluis, et al.,
bioRxiv - Immunology 2021
Quote:
... were added to Calu-3 cells in 50 μL PBS and antibodies neutralizing IFNα (mouse anti-human IFN alpha antibody, clone MMHA-2, PBL Assay Science Cat#21100-2) or isotype control (Purified mouse IgG1 ...
-
No products found
because this supplier's products are not listed.
Rory N. Pruitt, et al.,
bioRxiv - Plant Biology 2020
Quote:
... Protein blotting was performed using antibodies against GFP (Torrey Pines Biolabs, Secaucus, New Jersey, US), HA (Sigma ...
-
No products found
because this supplier's products are not listed.
Wassim Eid, et al.,
bioRxiv - Cell Biology 2019
Quote:
... rabbit polyconal to 14-3-3 (SA-483, Biomol); rabbit polyconal to CHK1-pS345 (2348S ...
-
No products found
because this supplier's products are not listed.
Matthew R. McFarland, et al.,
bioRxiv - Systems Biology 2020
Quote:
... HA-tagged Gln4 protein was detected using an anti-HA antibody (HA.11 clone 16B12, Cambridge Biosciences) and SuperSignal West Femto substrate (Thermo Scientific ...
-
No products found
because this supplier's products are not listed.
Benjamin Kroppen, et al.,
bioRxiv - Biophysics 2020
Quote:
The ENTH WT (C96A A155C) domain and the ENTH R114A (C96A A155C) were labeled with Atto488 maleimide (or Atto532 maleimide) (ATTO-TEC GmbH, Siegen, Germany) by cysteine modification ...
-
No products found
because this supplier's products are not listed.
Nuno Apóstolo, et al.,
bioRxiv - Neuroscience 2020
Quote:
... MF-CA3 synaptosomes were labeled in non-permeabilizing conditions in PBS with an anti-Nectin 3 monoclonal antibody (1:50; Hycult Biotech) directly conjugated with CF488A fluorophore (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Anne-Sophie Hafner, et al.,
bioRxiv - Neuroscience 2019
Quote:
... The next day grids were washed 5x 3 min with TBS before being incubated with anti-rabbit antibody coupled to ~10mn colloidal gold (BBI solution, 1:50) for 2 h ...
-
No products found
because this supplier's products are not listed.
Koki Yoshimoto, et al.,
bioRxiv - Bioengineering 2023
Quote:
... 3 µM CHIR99021(ReproCELL, Kanagawa, Japan), and 1% (v/v ...
-
No products found
because this supplier's products are not listed.
Félix Buron, et al.,
bioRxiv - Neuroscience 2023
Quote:
... etched tungsten microelectrodes (3-5MΩ, FHC) that were inserted into the brain using 26-gauge guide tubes that were passed through the recording grid and small predrilled burr holes in the skull ...
-
No products found
because this supplier's products are not listed.
Brandon S. Johnson, et al.,
bioRxiv - Plant Biology 2023
Quote:
... and a 3 hr Solusol (National Diagnostics) digestion to dissolve the cell wall fraction ...
-
No products found
because this supplier's products are not listed.
Ivan Corbeski, et al.,
bioRxiv - Biochemistry 2023
Quote:
... 3 nM XL665-conjugated streptavidin (Cisbio, 610SAXLB), 1x anti-GST Eu3+-labelled antibody (from 400x stock (Cisbio ...
-
No products found
because this supplier's products are not listed.
Michael J. Pereira, et al.,
bioRxiv - Microbiology 2021
Quote:
... or C1s proteins (Complement Technologies), or BSA (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Kristin D. Dahl, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... MBP (Myelin Basic Protein, Neuromics Cat # ...
-
No products found
because this supplier's products are not listed.
Seren Hamsici, Gokhan Gunay, Handan Acar,
bioRxiv - Bioengineering 2022
Quote:
... Fmoc protected amino acids (Gyros Protein Technologies) were removed through treatment with 20% piperidine/DMF solution for 45 min (three times for 15 min ...
-
No products found
because this supplier's products are not listed.
Claudio A. Carril Pardo, et al.,
bioRxiv - Cell Biology 2021
Quote:
... anti-Urocortin 3 (rabbit, 1:300, Phoenix Pharmaceuticals H-019-29), anti-Pdx1 (guinea pig ...
-
No products found
because this supplier's products are not listed.
Anna Bludau, et al.,
bioRxiv - Neuroscience 2020
Quote:
... nuclear proteins were extracted using the EpiQuick Nuclear Extraction Kit (Epigentek) according to the manufacturer’s protocol.
-
Recombinant Antigen
Cat# ZEBO-VLP-100,
100µg USD $785.0
Ask
Alexander A. Lehmann, et al.,
bioRxiv - Immunology 2020
Quote:
... truncated Spike protein (S1 domain) (The Native Antigen Company, Oxford, UK) or receptor binding domain (RBD ...
-
Recombinant Human BMP2 protein was expressed in Escherichia coli.
Cat# BMP2-01H,
50ug , USD $298
Ask
Sunil Yeruva, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Recombinant protein of human DSG2 tagged with IgG Fc domain (Fc) (Creative Biomart; #DSG2-1601H) and N-CAD-Fc (Sino Biological ...
-
No products found
because this supplier's products are not listed.
Haley E. Adcox, et al.,
bioRxiv - Microbiology 2023
Quote:
... predicted atomic protein docking interactions between Ank5 and the NLRC5 NACHT domain using the SwarmDock algorithm.135 Protean 3D (DNASTAR) was used to visually depict the NovaDock predictions.
-
Leucine Rich Repeats And Immunoglobulin Like Domains Protein 3 (LRIG3) Antibody is a Rabbit...
Cat# abx375951-100UG,
100 µg USD $391.5
Ask
Mohadeseh Hasanpourghadi, et al.,
bioRxiv - Immunology 2022
Quote:
... A monoclonal antibody to N protein (Abbexa, MCA6373, lot# 156962) served as a positive control (data not shown).
-
No products found
because this supplier's products are not listed.
Yan Ni, et al.,
bioRxiv - Bioengineering 2020
Quote:
... and C-reactive protein antibodies C6 (4C28cc) and C135 (4C28) were obtained from Hytest. Therapeutic antibodies cetuximab and infliximab were obtained via the Catherina hospital pharmacy in Eindhoven and Maxima Medisch Centrum pharmacy in Veldhoven ...
-
No products found
because this supplier's products are not listed.
Mahdi Ghorbani, et al.,
bioRxiv - Biophysics 2024
Quote:
... The mutant ΔPAS EAG1 channel in pGH19 with the deletion of the PAS domain residues 2-130 was generated by Bio Basic Inc ...
-
No products found
because this supplier's products are not listed.
Lauriane Cornuault, et al.,
bioRxiv - Physiology 2022
Quote:
... ATP2A2 protein level was evaluated by SDS PAGE using rabbit anti-ATP2A2 antibodies (Badrilla, Cat# A010- 80). PLN phosphorylation at Serine 16 and Threonin 17 was evaluated by SDS PAGE using rabbit anti-phospho-PLN Ser16 (Badrilla ...
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
Alan Bush, et al.,
bioRxiv - Neuroscience 2021
Quote:
... strips with 54 or 63 contacts each (platinum 1 mm disc contacts arranged in a 3×18 or 3×21 layout, with 3 mm center to center spacing, PMT Cortac Strips models 2110-54-001 and 2011-63-002 ...
-
No products found
because this supplier's products are not listed.
Alexis Bouin, et al.,
bioRxiv - Microbiology 2022
Quote:
... diluted 1:500 in blocking solution for detection of viral protein VP1 or anti dsRNA antibody (SCICONS, anti-dsRNA mAb J2, 10010500) diluted 1:1000 in blocking solution overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Zhi Liu, et al.,
bioRxiv - Physiology 2022
Quote:
... and rectal probe (Kent Scientific, RET-3). Before recording temperatures ...
-
No products found
because this supplier's products are not listed.
Pojeong Park, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 4-[(2S)-2-[(5-isoquinolinylsulfonyl)methylamino]-3-oxo-3-(4-phenyl-1-piperazinyl)propyl] phenyl isoquinolinesulfonic acid ester (KN-62; Tocris and HelloBio); D-AP5 (HelloBio) ...
-
No products found
because this supplier's products are not listed.
Luca A. Andronico, et al.,
bioRxiv - Biophysics 2024
Quote:
... 1-palmitoyl-2-oleoyl-glycero-3-phosphocholine (POPC) and 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC)) were purchased from Bangs Laboratories and Avanti Polar Lipids ...
-
No products found
because this supplier's products are not listed.
Christopher Cyrus Kuhn, et al.,
bioRxiv - Cell Biology 2022
Quote:
S protein (Cube Biotech #28703) and isolated platelets were mixed at final concentrations of 0.2 μg/ml ...
-
No products found
because this supplier's products are not listed.
Chao Gao, et al.,
bioRxiv - Biochemistry 2020
Quote:
... for 3 min and separated on a C18 analytical column (picofrit 75 μm ID x 150 mm, 3 μm, New Objective) using a linear gradient of 2 % to 45 % solvent B (80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Michael H. Myoga, et al.,
bioRxiv - Neuroscience 2023
Quote:
... 3 mm tip-diameter reusable feeding needle (Fine Science Tools), operated using a normally closed pinch valve (NResearch ...
-
No products found
because this supplier's products are not listed.
Jacob W. Myerson, et al.,
bioRxiv - Bioengineering 2020
Quote:
... with separate compartments for each mouse (MPC-3 AERO; Braintree Scientific). To maintain adequate hydration ...
-
No products found
because this supplier's products are not listed.
Kosuke Fukui, et al.,
bioRxiv - Plant Biology 2021
Quote:
... and desalted by Spectra/Por® Dialysis Membrane 3 (Spectrum Labs, USA) with Buffer IV (10 mM NaCl ...
-
No products found
because this supplier's products are not listed.
Frederike Winkel, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and 3) rabbit anti-phospho Kv3.1 (1:100) (#75-041, Phosphosolutions, Aurora, CO) overnight at +4° C ...