-
No products found
because this supplier's products are not listed.
Vitor Mendes, et al.,
bioRxiv - Biochemistry 2020
Quote:
... was mixed in 1:1 and 1:2 (protein to reservoir) ratio with well solution using a mosquito robot (TTP labtech). Initial conditions were obtained in the Classics lite crystallization screen (Qiagen) ...
-
No products found
because this supplier's products are not listed.
Daria A. Egorova, et al.,
bioRxiv - Microbiology 2022
Quote:
... Total protein quantity was measured with QuDye Protein kit (Lumiprobe) on Qubit fluorometer (ThermoScientific).
-
No products found
because this supplier's products are not listed.
Alexis M. Crockett, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Primary antibodies polyclonal rabbit anti-rat/mouse fibrinogen (1:300; Innovative research), polyclonal rabbit anti-mouse/human claudin-5 (1:300 ...
-
No products found
because this supplier's products are not listed.
Yuxin Wang, Chen Su, Chengong Ji, Junyu Xiao,
bioRxiv - Biochemistry 2023
Quote:
... Then the proteins were mixed with equal amounts of normal human serum complement (1:12.5, Quidel) and OCI-Ly10 cultures (20,000 cells ...
-
No products found
because this supplier's products are not listed.
Yan Liu, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and anti-mouse collagen II antibody cocktail (1 mg/mL; Chondrex Inc, Woodinville, WA) at a mass ratio of 1:1 for 1 hour at 37°C 25 ...
-
LC Laboratories' Product Number I-5022 - Ixabepilone, Free Base (Azaepothilone B, BMS-247550,...
Cat# I-5022, SKU# I-5022_1mg,
1 mg, $129.00
Ask
Rohan N. Shah, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 1 µM PD0325901 (LC Laboratories), sterilized using 0.1 µm filter flask (Millipore) ...
-
No products found
because this supplier's products are not listed.
Talia Bergaglio, et al.,
bioRxiv - Pathology 2023
Quote:
Platelet-rich plasma (PRP) was commercially obtained (BioIVT) for healthy and convalescent COVID-19 donors ...
-
No products found
because this supplier's products are not listed.
Yongchan Lee, et al.,
bioRxiv - Biochemistry 2023
Quote:
14C-leucine (338 mCi/mmol) was purchased from Moravek Biochemicals (Brea ...
-
No products found
because this supplier's products are not listed.
Suman Khan, et al.,
bioRxiv - Microbiology 2023
Quote:
... 10.8% Drug Like Set (Enamine, Ukraine), 26.8% DiversetCL (Chembridge ...
-
Recombinant HTLV-1 gp46 protein, fused to His-tag, was expressed in HEK293.
Cat# GB46-01VH,
50ug , USD $298
Ask
Sunil Yeruva, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Recombinant protein of human DSG2 tagged with IgG Fc domain (Fc) (Creative Biomart; #DSG2-1601H) and N-CAD-Fc (Sino Biological ...
-
No products found
because this supplier's products are not listed.
Benjamin M. Lorton, et al.,
bioRxiv - Biochemistry 2023
Quote:
... The antibodies against Xenopus laevis Npm2 and Npm2 core domain were generated by Lampire Biological Laboratories (Pipersville ...
-
No products found
because this supplier's products are not listed.
L. Sheneman, G. Stephanopoulos, A. E. Vasdekis,
bioRxiv - Microbiology 2021
Quote:
... 0.69 g/L complete supplement mixture without Leucine from Sunrise Science Products, 1.1□g/L ammonium sulfate from Fisher and 75 g/L glucose from Fisher ...
-
No products found
because this supplier's products are not listed.
Haley E. Adcox, et al.,
bioRxiv - Microbiology 2023
Quote:
... predicted atomic protein docking interactions between Ank5 and the NLRC5 NACHT domain using the SwarmDock algorithm.135 Protean 3D (DNASTAR) was used to visually depict the NovaDock predictions.
-
No products found
because this supplier's products are not listed.
Dipsikha Biswas, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 120 uL of internal standard (ISTD; 4 ug/ml in H2O containing leucine-d3 (CDN Isotopes, D-1973) and 0.8 ng/uL in H2O containing sodium-2-Keto-3-methyl-d3-butyrate-3,4,4,4d4 (KIVd7 ...
-
No products found
because this supplier's products are not listed.
Washington C. Agostinho, Paulo E. Brandão,
bioRxiv - Molecular Biology 2019
Quote:
FITC-antibody control protein (Gelantis) complexed with Bioporter® Protein Delivery Reagent (Genlantis) per manufacturer’s instructions were injected by the intracerebral route in two mice and the CNS of each mouse was collected at 4 and 6 hours post-infections ...
-
No products found
because this supplier's products are not listed.
Sean M. Harris, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... Cells used in experiments were within twenty passage numbers from arrival into the laboratory and were routinely verified by their short tandem repeat profiles using fragment analysis (ABI 3730XL DNA Analyzer ...
-
No products found
because this supplier's products are not listed.
Romina Marone, et al.,
bioRxiv - Bioengineering 2023
Quote:
... The extracellular domain (ECD) of CD123 WT and variants were produced and purified by Icosagen.
-
No products found
because this supplier's products are not listed.
Satoshi Imanishi, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... and caspase-like (β1) activities of the 20S proteasome were measured using a 20S Proteasome Activity Kit GOLD (StressMarq Bioscience Inc. ...
-
No products found
because this supplier's products are not listed.
Youssouf Sereme, et al.,
bioRxiv - Microbiology 2020
Quote:
Specific immunoglobulins were identified (IgG and IgA) by ELISA according the manufacturer’s instructions (Poliomyelitis virus kit, GenWay, San Diego, California, USA). The polio antigen derived from the human pathogenic poliovirus types ...
-
No products found
because this supplier's products are not listed.
Takanori Eguchi, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... Cells were blocked in IHC/ICC blocking buffer high protein (eBioscience, San Diego, CA) for 10 min and then reacted with anti-MZF1 antibody (1:50, C10502; Assay Biotechnology, Fremont, CA) and AlexaFluor488 secondary antibody (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Julio David Vega-Torres, et al.,
bioRxiv - Neuroscience 2021
Quote:
... 5-gm% fat, product #F7463) and Western-like high-saturated fat diet (WD, 20-gm% fat, product #F7462) were obtained from Bio-Serv (Frenchtown, NJ, USA). The macronutrient composition and fatty acid profiles are detailed in a previous study and summarized in Supplemental Table 1 (Vega-Torres et al. ...
-
No products found
because this supplier's products are not listed.
Hua He, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... or NKX2-1 antibody (Seven Hills Bioreagents, WRAB-1231, 1:1000) followed by incubation with TrueBlot HRP-Conjugated secondary antibody (Rockland Immunochemicals Inc ...
-
No products found
because this supplier's products are not listed.
Susannah S. Adel, et al.,
bioRxiv - Neuroscience 2022
Quote:
... a solution containing AAV9.hsyn viruses encoding either full-length or the extracellular domain of either Sema4D or CD4 (designed and purified by Vector Biolabs) in combination with the same amount of AAV9.hsyn.GFP virus (Addgene ...
-
No products found
because this supplier's products are not listed.
Dennis S. Metselaar, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... glial fibrillary acidic protein (GFAP) (1:500; BT46-5002–04, BioTrend), S100 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
Benjamin Kroppen, et al.,
bioRxiv - Biophysics 2020
Quote:
The ENTH WT (C96A A155C) domain and the ENTH R114A (C96A A155C) were labeled with Atto488 maleimide (or Atto532 maleimide) (ATTO-TEC GmbH, Siegen, Germany) by cysteine modification ...
-
No products found
because this supplier's products are not listed.
Bradley M. Roberts, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Primary antibodies: rabbit anti-NeuN (1:500, Biosensis, R-3770–100). Sections were then incubated in species-appropriate fluorescent secondary antibodies with minimal cross-reactivity for 2 hours in PBS-Tx with 2% NDS at room temperature ...
-
No products found
because this supplier's products are not listed.
Mengqi Luo, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Membranes with protein samples subsequently reacted with anti-ACTB (1:5000, pAb, ZEN BIO, China), anti-SCRN2 (1:500 ...
-
No products found
because this supplier's products are not listed.
Anno Saris, et al.,
bioRxiv - Immunology 2020
Quote:
... Anti-RBD and anti-NP IgG antibodies were measured in EDTA plasma samples at 100-1200 fold dilutions using ELISA as previously described.11 Plates were coated with RBD or N protein and specific IgG antibodies were detected using anti-human IgG (MH16, Sanquin).
-
No products found
because this supplier's products are not listed.
Anil Verma, et al.,
bioRxiv - Immunology 2023
Quote:
... were labeled with biotinylated anti-His tag monoclonal antibody (ThermoScientific) and used to capture His-tagged clade C gp120 Du151 protein (Immune Technologies). The gp120-expressing beads were then incubated with triplicate 5-fold dilutions of heat-inactivated serum samples in V-bottom plates for 1h at 37°C ...
-
No products found
because this supplier's products are not listed.
Elena Terraza-Silvestre, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Primary antibodies were: anti-LC3 (1/200, 5F10, mouse mAb, NanoTools 0231-100) or anti-AU (1/1000 ...
-
No products found
because this supplier's products are not listed.
Sebastian Pöhl, et al.,
bioRxiv - Microbiology 2023
Quote:
... Protein was then purified using zinc-affinity chromatography using a 1 mL Zn-NTA column (Cube Biotech) equilibrated with lysis buffer containing 5 mM imidazole ...
-
No products found
because this supplier's products are not listed.
Elizabeth C. Stahl, et al.,
bioRxiv - Bioengineering 2023
Quote:
... RNPs were prepared immediately before use at a 1.2:1 molar ratio of single guide RNA (Synthego, Redwood City, CA) to protein (QB3 Macrolab or Aldevron). The solution was incubated for 5-10 minutes at room temperature ...
-
No products found
because this supplier's products are not listed.
Isadora Matias, et al.,
bioRxiv - Neuroscience 2021
Quote:
Protein concentration in cell extracts was measured by the BCA Protein Assay Kit (Cole-Parmer). Forty micrograms protein/lane was electrophoretically separated on a 10% SDS polyacrylamide gel and electrically transferred onto a Hybond-P PVDF transfer membrane (Millipore ...
-
No products found
because this supplier's products are not listed.
Celia Fernandez-Sanz, et al.,
bioRxiv - Physiology 2021
Quote:
Equal amounts of protein (70 μg) supplemented with 5x Protein Loading Buffer (National Diagnostics, USA) were preheated (95°C ...
-
No products found
because this supplier's products are not listed.
Sankalp Shukla, et al.,
bioRxiv - Cell Biology 2022
Quote:
... ALG-2 was detected using the PDCD6 Rabbit Polyclonal Antibody (no. 12303-1-AP, Thomas Scientific), ALIX ...
-
No products found
because this supplier's products are not listed.
Yilun Sun, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... AcquaStain protein gel Coomassie stain (Bulldog Bio); Silver Stain solutions (Bio-Rad).
-
No products found
because this supplier's products are not listed.
Rahul Kumar, et al.,
bioRxiv - Cell Biology 2023
Quote:
... T7-RILP proteins were expressed in Escherichia coli BL21 (500 μM isopropyl β-d-1-thiogalactopyranoside; Wisent Bioproducts; at room temperature for 16 hours) and purified using standard procedure in tris buffer [20 mM tris (pH 7.4) ...
-
No products found
because this supplier's products are not listed.
Coralie Berthoux, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Recombinant human BDNF protein was purchased from Hello Bio. Salts for making ACSF and internal solutions were purchased from Sigma-Aldrich.
-
No products found
because this supplier's products are not listed.
Ugo Sardo, et al.,
bioRxiv - Physiology 2023
Quote:
Liver proteins were extracted by physical dissociation (Ultra-turrax, IKA) in PEB Buffer (150 mM NaCl ...
-
No products found
because this supplier's products are not listed.
Kourosh Kouhmareh, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... The labeled HA plus a combination of biotinylated monoclonal antibodies was mixed at a 1:16 ratio into phosphate buffered saline (PBS, 1X Caisson Labs PBL01-500ML) along with 0.1% Tween-20. ...
-
No products found
because this supplier's products are not listed.
Frederike Klimm, Thomas Speck, Marc Thielen,
bioRxiv - Plant Biology 2023
Quote:
... by using the primary antibody LM6 ([Anti-1,5-α-L-Arabinan] Antibody, Megazyme Ltd, Bray, Ireland) and a fluorescent marker (Alexa Fluor 568 goat anti-rat IgG (H+L) ...
-
No products found
because this supplier's products are not listed.
Shane Miersch, et al.,
bioRxiv - Synthetic Biology 2020
Quote:
Fifty micrograms of protein were injected onto a TSKgel BioAssist G3SWxl (Tosoh) fitted with a guard column using an NGC chromatography system and a C96 autosampler (Biorad) ...
-
No products found
because this supplier's products are not listed.
Bevin C. English, et al.,
bioRxiv - Immunology 2022
Quote:
... proteins were extracted from samples collected in TRI Reagent (Molecular Research Center) according to a modified protocol (65) ...
-
No products found
because this supplier's products are not listed.
Bryan D. Ryder, et al.,
bioRxiv - Biochemistry 2020
Quote:
... the protein solution was loaded into 3.5kDa cutoff Biotech CE Dialysis Tubing (Spectrum Labs) and dialyzed overnight at 4°C in 1xPBS to restore native folding ...
-
No products found
because this supplier's products are not listed.
Paweł P. Knejski, et al.,
bioRxiv - Biochemistry 2023
Quote:
... purified proteins were diluted to 0.05 mg/mL and applied onto plasma-cleaned (Gatan Solarus) copper grids with a continuous carbon layer (Electron Microscopy Sciences) ...
-
No products found
because this supplier's products are not listed.
Carmanah Hunter, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Polysialylated proteins were eluted by incubating twice with 200 μL 25 mg/mL colominic acid (Carbosynth) at room temperature for 1 – 2 h and collecting the supernatant ...
-
No products found
because this supplier's products are not listed.
Marie E Jönsson, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 1 mM DTT) using a 1 ml tissue douncer (Wheaton). The homogenate was carefully layered on top of a sucrose cushion (1.8 M sucrose ...
-
No products found
because this supplier's products are not listed.
Julia Böhme, et al.,
bioRxiv - Immunology 2020
Quote:
The activity of caspase-1 was determined using fluorescent inhibitor of caspase-1 (FAM-Flica Caspase-1 Assay kit, ImmunoChemistry Technologies). Staining procedure was performed according to manufactures protocol ...
-
No products found
because this supplier's products are not listed.
Jorge Mauricio Reyes-Ruiz, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Monoclonal antibodies were diluted in protein array blocking buffer (GVS, Sanford, ME, USA) to a final concentration of 5 ng/ml ...