-
No products found
because this supplier's products are not listed.
Mohita Tagore, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... or DMH1 (BMP receptor, Sigma #D8946, 0.5 µM) or EC330 (LIF receptor ...
-
No products found
because this supplier's products are not listed.
Tetsuro Yamamoto, et al.,
bioRxiv - Immunology 2023
Quote:
... Monkey IFN alpha (pan) ELISA Kit (LifeSpan BioSciences Inc), Monkey IFN-gamma ELISA Kit (U-CyTech biosciences) ...
-
No products found
because this supplier's products are not listed.
Ami Vadgama, et al.,
bioRxiv - Immunology 2023
Quote:
... 0.3-30μM thrombin-receptor activating peptide 6 (TRAP-6; Cambridge Biosciences); 0.3-30μM U46619 (Enzo Life Sciences) ...
-
No products found
because this supplier's products are not listed.
Mehul S. Suthar, et al.,
bioRxiv - Immunology 2021
Quote:
... horseradish peroxidase conjugated goat anti-monkey IgG (γ-chain specific, Alpha Diagnostics, 1:4,000 dilution), in PBS-T containing 1% non-fat milk was added and incubated for 1 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Rory Henderson, et al.,
bioRxiv - Immunology 2023
Quote:
... The synthetic Toll-like receptor 7/8 agonist 3M-052 absorbed to ALUM (3M-052-ALUM) was used as the adjuvant for the vaccine immunogens ...
-
No products found
because this supplier's products are not listed.
Yash Agarwal, et al.,
bioRxiv - Immunology 2020
Quote:
... Paraffin embedded fixed sections were stained via hematoxylin and eosin or with indicated human antibodies 24 (anti-human CD45-Biocare Medical Cat. No. CME PM016AA; anti-human CD3-Biocare Medical Cat ...
-
No products found
because this supplier's products are not listed.
Hugo Girão, et al.,
bioRxiv - Cell Biology 2019
Quote:
... using NZYColour Protein Marker II (NZYTech). Blotting was performed with an iBlot Gel Transfer System (Invitrogen) ...
-
No products found
because this supplier's products are not listed.
Indira Wu, Hee Shin Kim, Tuval Ben-Yehezkel,
bioRxiv - Genomics 2019
Quote:
... while human liver total RNA and human blood total RNA were purchased from Zyagen. LoopSeq Transcriptome kit was obtained from Loop Genomics ...
-
No products found
because this supplier's products are not listed.
Michael Tellier, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Antibodies used: Pol II (MABI0601, MBL International) and Ser5P (MABI0603 ...
-
No products found
because this supplier's products are not listed.
Klara Filek, et al.,
bioRxiv - Microbiology 2022
Quote:
... PECS II (Gatan Inc., Pleasanton, CA, USA). The specimens were analysed with JEOL JSM-7800F scanning electron microscope (JEOL ...
-
No products found
because this supplier's products are not listed.
S Momsen Reincke, et al.,
bioRxiv - Immunology 2021
Quote:
... Human mAbs were applied and detected using HRP-conjugated anti-human IgG (Dianova, 709-035-149) and the HRP substrate 1-step Ultra TMB (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Katharina Hoette, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Isolation of organoids from the embedding matrix (human hepatic organoids: Matrigel, Corning; human pancreatic organoids: Cultrex BME2, Amsbio) for fixation and whole-mount staining was performed with slight modifications of protocols published by Broutier et al ...
-
No products found
because this supplier's products are not listed.
Matthew D. J. Dicks, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Human coagulation Factor X (hFX) (Haematologic Technologies) was added to diluted vectors at a final concentration of 8 μg/mL ...
-
No products found
because this supplier's products are not listed.
Christin Naumann, et al.,
bioRxiv - Plant Biology 2021
Quote:
... All reagents except human ceruloplasmin (Athens Research) were purchased from Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Maciej Kliszczak, et al.,
bioRxiv - Cell Biology 2023
Quote:
... rabbit anti-human FAM111B (HPA038637, Atlas Antibodies) at 1:1000 (IB and IF) ...
-
No products found
because this supplier's products are not listed.
Marco Di Gioia, et al.,
bioRxiv - Immunology 2023
Quote:
... recombinant human AKT1 (BPS Bioscience, Cat# 40003), AKT2 (BPS Bioscience ...
-
No products found
because this supplier's products are not listed.
Yukiko Yamaguchi, et al.,
bioRxiv - Immunology 2022
Quote:
... containing 100 U/mL recombinant human IL-2 (rhIL-2, Novartis Oncology) and 0.5 ng/mL recombinant human IL-15 (rhIL-15, CellGenix). For CAR lentiviral transduction ...
-
No products found
because this supplier's products are not listed.
Tomás Bazzano, et al.,
bioRxiv - Evolutionary Biology 2020
Quote:
... and a transmission electron microscope (TEM JEOL-100 CX II). To obtain the SEM images ...
-
No products found
because this supplier's products are not listed.
Hannah A. Pizzato, et al.,
bioRxiv - Immunology 2023
Quote:
CHO cells were incubated with 1µg/mL anti-CHO antibody (Cygnus Technologies) for 30min at 4°C ...
-
In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I,...
Cat# PBCA1019,
Inquiry
Ask
Chih-Wei Chu, et al.,
bioRxiv - Immunology 2023
Quote:
CHO-K1 and CHO-K1 Fut8 KO cell lines (Creative Biogene, Shirley, NY) were cultured in RPMI-1640 media (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Dustin M. McCraw, et al.,
bioRxiv - Microbiology 2019
Quote:
The sera and plasma were diluted 1:4 in RDE (RDE II, “Seiken”, receptor-destroying enzyme, cat. no. UCC-340-122, Accurate Chemical) and placed in a 37°C water bath overnight (18-20 hr) ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
γ-Mangostin (Gamma-Mangostin) is a novel competitive 5-hydroxytryptamine 2A (5-HT2A) receptors...
Cat# S0939, SKU# S0939-1mg,
1mg, $219.00
Ask
Richard Kanyo, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... Receptor inhibitors AM251 (Selleck Chemicals, Houston, TX, USA) and AM630 (Adooq Bioscience ...
-
No products found
because this supplier's products are not listed.
Kari Salokas, et al.,
bioRxiv - Systems Biology 2021
Quote:
... and 1 mM γ[18O4]-ATP (Cambridge Isotope Laboratory) in 30 °C for 1 hour ...
-
No products found
because this supplier's products are not listed.
Charles N.S. Allen, et al.,
bioRxiv - Microbiology 2023
Quote:
... IFN-β levels were measured by a plate reader (BioTek ELx800).
-
No products found
because this supplier's products are not listed.
Koushik Debnath, et al.,
bioRxiv - Bioengineering 2024
Quote:
... and recombinant human FN III 12,13 N-GST (“HBDII”, which is derived from heparin-binding domain II of FN; #EUR120, Kerafast). Sheared DNA molecules were then added dropwise with continuous stirring at 400∼500 rpm with the final concentration of 10 µg/ml ...
-
No products found
because this supplier's products are not listed.
Supaporn Suparak, et al.,
bioRxiv - Immunology 2022
Quote:
The level of anti-RBD IgG antibodies was measured in human plasma by chemiluminescent microparticle assay (CMIA) using the SARS-CoV-2 IgG II Quant (Abbott, USA) on the ARCHITECT I System (Abbott ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... P-ser375 MOR (rabbit anti-mu opioid receptor Ser375, BIOSS-Stratech, bs-3724R, 1:500), and β-actin (mouse anti-β-actin ...
-
No products found
because this supplier's products are not listed.
Jaime A. Freire-Arvelo, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Optical density of D2 receptors of each sample was obtained using Odyssey software (LI-COR Biosciences), normalized against background ...
-
No products found
because this supplier's products are not listed.
O Bogen, et al.,
bioRxiv - Neuroscience 2024
Quote:
... psi ε receptor for activated C kinase (ψεRACK) (27) was purchased from Biomatik (Wilmington, DE, USA), and the proinflammatory cytokine prostaglandin-E2 (PGE2 ...
-
No products found
because this supplier's products are not listed.
Mariana Romeiro Motta, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... and γ-tubulin was stained using a monoclonal antibody also raised in mouse (Agrisera, AS20 4482). Since the primary antibodies were raised in the same species ...
-
No products found
because this supplier's products are not listed.
Catherine Naughton, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... RNA Polymerase II (Diagenode, C15100055), RNA Polymerase II (gift from H ...
-
No products found
because this supplier's products are not listed.
Jan Steinkühler, et al.,
bioRxiv - Biophysics 2020
Quote:
... Human Transferrin – CF488A (Biotium) at 130 nM ...
-
No products found
because this supplier's products are not listed.
Halilibrahim Ciftci, et al.,
bioRxiv - Microbiology 2021
Quote:
... and Wizard I & II (Molecular Dimensions). First crystallization condition contained 25% (w/v ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
Interferon Gamma (IFN-γ) Antibody Pair for use in Sandwich ELISA assay development.
This...
Cat# abx378062-5×96T,
5 × 96 tests USD $609.0
Ask
Michaela Frolikova, et al.,
bioRxiv - Cell Biology 2023
Quote:
... diluted 1:50 in 1% BSA in PBS and rabbit polyclonal anti-Folate receptor 4 (Juno) (abx102438, Abbexa, UK) diluted 1:50 in 1% BSA in PBS followed by 1 hr ...
-
No products found
because this supplier's products are not listed.
Shlomit Edri, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... or 1 µM XXI (Compound E, γ-secretase and Notch signalling pathway inhibitor, AdipoGen Life Sciences AG-CR1-0081).
-
No products found
because this supplier's products are not listed.
Balaji Karthick Subramanian, et al.,
bioRxiv - Pathology 2019
Quote:
... Human primary podocytes from Celprogen Inc ...
-
No products found
because this supplier's products are not listed.
George R. Heaton, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... added to the Bio-safe II (RPI) scintillation cocktail and binding quantified using scintillation counting for H3 on an Tri-Carb 2810TR scintillation counter (Perkin Elmer).
-
Recombinant COVID-19 Spike protein receptor binding domain (RBD) was fused to His-tag at...
Cat# Spike-190V,
50ug , USD $368
Ask
Noah R. Johnson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... recombinant human apoA-I (Creative Biomart), human plasma-derived apoE (Sigma) ...
-
No products found
because this supplier's products are not listed.
Manuel Göpferich, et al.,
bioRxiv - Neuroscience 2020
Quote:
... human FGF (20 ng/μl, ReliaTech) and human EGF (Promokine) ...
-
No products found
because this supplier's products are not listed.
Sk. Kayum Alam, et al.,
bioRxiv - Cancer Biology 2022
Quote:
Human DARPP-32 isoforms purified from NSCLC cells were incubated with kinase-activated human IKKα protein (SignalChem) for in vitro kinase assays by following previously described methods70 ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
R. Chittajallu, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Glutamate receptor mediated synaptic responses (EPSCs and EPSPs) were evoked with A360 constant-current stimulus isolator (World Precision Instruments, Sarasota, FL, USA) and with stimulation electrodes pulled from borosilicate glass filled with aCSF placed in SLM in the presence 50μM picrotoxin ...
-
No products found
because this supplier's products are not listed.
Surya D. Aggarwal, et al.,
bioRxiv - Microbiology 2021
Quote:
... Plasmid DNA Mini Kit II (OMEGA bio-tek, USA), and transformed into pneumococcal strains and selected on Columbia agar plates supplemented with kanamycin (150μg/ml).
-
No products found
because this supplier's products are not listed.
Corinne Suter, et al.,
bioRxiv - Microbiology 2023
Quote:
... MDCK II cells were seeded in TC inserts (Sarstedt). The cells were pre-treated with the inhibitors at pH 7.4 and incubated at 37 °C for 1 h ...
-
No products found
because this supplier's products are not listed.
Moeez Rathore, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... supplemented with 10% human serum (Atlanta Biologicals) and antibiotics-antimycotic (1x ...
-
No products found
because this supplier's products are not listed.
V. Praveen Chakravarthi, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... 30 IU of human chorionic gonadotropin (hCG; BioVendor) was injected intraperitoneally ...
-
No products found
because this supplier's products are not listed.
Nicholas B. Karabin, et al.,
bioRxiv - Bioengineering 2020
Quote:
... Pooled human plasma was acquired from Zen-Bio Inc ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...