-
Magnetofection
diificult to transfect cells
Cat# KC30400,
SilenceMag 200µL + PolyMag 100µL + PolyMag Neo 100µL+ CombiMag 100µL + Magnetic plate MF10000, USD $798.00/KIT
Ask
Ariel Caviedes, et al.,
bioRxiv - Neuroscience 2020
Quote:
Neuronal cultures of 7 DIV were transfected using magnetic nanoparticles (NeuroMag, Oz Biosciences). Briefly ...
-
This product is an ELISA kit for the determination of Acetylcholine Receptor Autoantibody in...
Cat# NAK-014,
1.0 case, Inquiry
Ask
Kylie M. Konrath, et al.,
bioRxiv - Immunology 2021
Quote:
CHO cells expressing human ACE2 receptors (VCel-Wyb030) were obtained from Creative Biolabs (Shirley, NY). CHO-ACE2 cells were seeded at 10,000 cells/well in 96-well plates and incubated for 24 hours ...
-
No products found
because this supplier's products are not listed.
Yasuaki Uehara, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Phosphate homeostasis hormones were measured in mouse and human serum using the FGF-23 ELISA Kit (Kainos Laboratories Inc., Tokyo, Japan), the mouse or human PTH 1-84 ELISA Kit (Immutopics ...
-
No products found
because this supplier's products are not listed.
Julio Aleman, et al.,
bioRxiv - Bioengineering 2021
Quote:
... The secreted levels of alpha-GST by the organoids were quantified using a GST alpha assay kit (GS41, Oxford Biomedical Research; Rochester Hills, MI). Absorbance was read on a Spectramax M5 plate reader (Molecular Devices ...
-
No products found
because this supplier's products are not listed.
Keiji Nakamura, et al.,
bioRxiv - Microbiology 2024
Quote:
... As the ELISA kit (RIDASCREEN Verotoxin; R-Biopharm AG) became unavailable in Japan during this study ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Yuan Zhang, Zhigang Liu, Bin Zhang,
bioRxiv - Cell Biology 2022
Quote:
... FV antigen was quantified by ELISA using matched-pair antibody set for human FV antigen from Affinity Biologicals. All assays were performed according to manufacturers’ instructions.
-
No products found
because this supplier's products are not listed.
Hannah Donnelly, et al.,
bioRxiv - Bioengineering 2024
Quote:
... Enzyme-linked immunosorbent assays (ELISA) was then carried out as per manufacturer’s instructions (R&D Systems, BMP-2 DuoSet ELISA kit, DY355). Briefly ...
-
No products found
because this supplier's products are not listed.
Estrela Neto, et al.,
bioRxiv - Cell Biology 2020
Quote:
... a multi-neurotrophin rapid screening ELISA kit (#BEK-2231, Tebu-bio, France) was used according to the manufacturers’ protocol ...
-
No products found
because this supplier's products are not listed.
Angela M. Bosco-Lauth, et al.,
bioRxiv - Microbiology 2020
Quote:
... Positive control antibodies to the receptor-binding domain (RBD) and full-length spike protein were human MAb CR3022 antibody (Absolute Antibody, Oxford UK) and human IgG whole molecule (Jackson Immuno Research ...
-
No products found
because this supplier's products are not listed.
Julia MT Ledderose, et al.,
bioRxiv - Neuroscience 2023
Quote:
... blue fluorescent neuronal tracer fast blue (Polyscience Inc, 17740-1, 1mg) onto the surface of L1 for 5 minutes ...
-
No products found
because this supplier's products are not listed.
Razieh Rafieenia, et al.,
bioRxiv - Microbiology 2022
Quote:
... Glyphosate concentrations were measured using a glyphosate ELISA kit (Abraxis, Eurofin Technologies, Hungary).
-
No products found
because this supplier's products are not listed.
Anna M.R. Hayes, et al.,
bioRxiv - Physiology 2023
Quote:
... Total starch in each diet was determined using a total starch analysis kit (amyloglucosidase/alpha-amylase method; Total Starch Assay Kit [AA/AMG], K-TSTA-50A, Megazyme, Wicklow, Ireland). Amounts of rapidly digestible starch (RDS) ...
-
No products found
because this supplier's products are not listed.
Christina M. Kelliher, et al.,
bioRxiv - Genomics 2020
Quote:
... anti-Tubulin alpha (1:10,000, Fitzgerald # 10R-T130a), or anti-CK1a (1:1000 ...
-
No products found
because this supplier's products are not listed.
Thomas S. Lisse,
bioRxiv - Cancer Biology 2020
Quote:
... The vitamin D receptor antagonist ZK159222 (VAZ, Toronto Research Chemicals) was reconstituted in ethanol and kept at −80°C (Ochiai E et al ...
-
No products found
because this supplier's products are not listed.
Shirsha Saha, et al.,
bioRxiv - Biophysics 2023
Quote:
... receptor was solubilized in 0.5% L-MNG (Anatrace, Cat. no: NG310) and 0.1% cholesteryl hemisuccinate (Sigma ...
-
No products found
because this supplier's products are not listed.
Erin M. Harberts, et al.,
bioRxiv - Immunology 2021
Quote:
... to Immulon ELISA plates (ImmunoChemistry Technologies) that were pre-coated with anti-IL-1β capture antibody (eBioscience) ...
-
No products found
because this supplier's products are not listed.
Xinquan Liu, Debadyuti Ghosh,
bioRxiv - Bioengineering 2019
Quote:
... and Cyanine 7 (Cy7, Lumiprobe) was conjugated to monomeric BSA according to manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Pierluigi Di Chiaro, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... anti-Collagen IV alpha 2 (3 μg/ml, Atlas Antibodies, #HPA069337), anti-LAMA5 (5 μg/ml ...
-
No products found
because this supplier's products are not listed.
Thomas Kampourakis, et al.,
bioRxiv - Biochemistry 2023
Quote:
The catalytic subunit was cloned into a pET15b vector and validated via sequencing by Bio Basic/(USA) ...
-
No products found
because this supplier's products are not listed.
Christopher W. Benson, et al.,
bioRxiv - Genomics 2023
Quote:
Fungal DNA was isolated from tissue grown in culture on potato dextrose agar (PDA; Alpha Biosciences Inc., Baltimore, MD) using the Fungi/Yeast Genomic DNA Isolation Kit (Norgen Biotek Corp., Ontario, Canada). High molecular weight DNA was prepared for sequencing using the SMRTbell Template Preparation kit (v.1.0) ...
-
No products found
because this supplier's products are not listed.
Eike-Christian Wamhoff, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... Sera were analyzed by ELISA for the presence of anti-dsDNA IgG and IgM using commercially available kits (Chondrex Inc. ...
-
No products found
because this supplier's products are not listed.
Tanay Ghosh, et al.,
bioRxiv - Neuroscience 2022
Quote:
... in QuantStudio 7 Flex (Applied Biosystems, ABI) machine ...
-
No products found
because this supplier's products are not listed.
Esther Cañibano, et al.,
bioRxiv - Plant Biology 2020
Quote:
... 2 ug total RNA extracted from 7 day old seedlings with the Favorprep Plant Total RNA Purification Mini kit (Favorgen) was used for cDNAs synthesis with using the High-Capacity cDNA Reverse Transcription kit (Applied Biosystems ...
-
No products found
because this supplier's products are not listed.
Fugui Niu, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and neuronal suspension was plated on acid-washed glass coverslips pre-coated with poly-D-lysine (Trevigen, 100 μg/ml) for 1 hr and laminin (Trevigen ...
-
Acetylcholine Assay Kit
Cat# EACL-100,
1.0 kit, 100 tests, USD $359.0
Ask
Yehezqel Elyahu, et al.,
bioRxiv - Immunology 2024
Quote:
... The levels of AST and ALT in murine serum were measured using EnzyChrom™ ELISA kits for AST and ALT (BioAssay Systems) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Elisa Vilardo, et al.,
bioRxiv - Biochemistry 2023
Quote:
The binding of the subunits of mtRNase P to different mitochondrial pre-tRNAs was measured by bio-layer interferometry on a BLItz instrument (Pall FortéBio). For immobilization on streptavidin-coated sensors pre-tRNAs were 5’- or 3’-end biotinylated ...
-
No products found
because this supplier's products are not listed.
John H. Day, et al.,
bioRxiv - Bioengineering 2024
Quote:
... CMs were plated on gelatin for 7 days (Cellular Dynamics) prior to drug treatment and incubated with Dox-containing media for 24 hours prior to fixation and subsequent sample preparation.
-
No products found
because this supplier's products are not listed.
Marina Boudigou, et al.,
bioRxiv - Immunology 2021
Quote:
... Pancoll human (PAN Biotech). CD19+ B cells were purified from human PBMCs using the REAlease® CD19 Microbead Kit (Miltenyi Biotec ...
-
No products found
because this supplier's products are not listed.
Mariah Beaver, et al.,
bioRxiv - Genomics 2021
Quote:
Chromatin was extracted and sheared from ~120 mg human hippocampus using truChIP Chromatin Shearing Kit (Covaris Inc., MA, USA) following the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
CUT&RUN assay libraries for cultured cells or human kidneys were generated with the CUTANA kit (EpiCypher, 14-1048). For cultured cells ...
-
AdvanStain Scarlet is a fluorescent stain for gels and blots that allows sensitive and...
Cat# K-11072-C25,
25 ml, USD $695.00/ea
Ask
Tomáš Kouba, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... RNAPs were detected by Western blotting using mouse monoclonal antibodies against the β subunit of RNAP (clone name 8RB13) and secondary antibodies conjugated with a fluorophore dye (WesternBrightTM MCF-IR, Advansta, 800 nm anti-mouse antibody) and scanned with an Odyssey reader (LI-COR Biosciences) ...
-
No products found
because this supplier's products are not listed.
Damian Dudka, R. Brian Akins, Michael A. Lampson,
bioRxiv - Cell Biology 2023
Quote:
... Centromeres were labeled with CREST (human anti-human Anti-Centromere Antibody, 1:200, Immunovision, HCT-0100) and an Alexa Fluor 594–conjugated goat anti-human secondary antibody (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Katharina Hoette, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Isolation of organoids from the embedding matrix (human hepatic organoids: Matrigel, Corning; human pancreatic organoids: Cultrex BME2, Amsbio) for fixation and whole-mount staining was performed with slight modifications of protocols published by Broutier et al ...
-
No products found
because this supplier's products are not listed.
Fabrizia Zevolini, et al.,
bioRxiv - Immunology 2023
Quote:
... CTLs at 5 days of differentiation were transiently transfected using the Human T cell nucleofector kit and the program T-023 of the Nucleofector II system (Amaxa Biosystems, Euroclone, Milan, Italy) for activated cells with 1 μg/106 cells of pEGFP-EB1 plasmid ...
-
No products found
because this supplier's products are not listed.
Francisco J. Pardo-Palacios, et al.,
bioRxiv - Genomics 2023
Quote:
... in human and from 2.5 (cDNA-PacBio) to 1.38 (dRNA-ONT) ...
-
No products found
because this supplier's products are not listed.
Kyung-Jin Jang, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
Alpha Glutathione S-Transferase (α-GST): levels were quantified in human model effluent samples from the upper channel using an ELISA kit (DiaPharma). The assay was run following the vendor protocol using a standard curve ranging from 0-64 µg/L ...
-
The chemical compound Acetylcholine Chloride(ACh chloride) is a neurotransmitter in both the...
Cat# S1805, SKU# S1805-25mg,
25mg, $97.00
Ask
Richard Kanyo, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... Receptor inhibitors AM251 (Selleck Chemicals, Houston, TX, USA) and AM630 (Adooq Bioscience ...
-
No products found
because this supplier's products are not listed.
Tingting Zhang, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Neuronal morphology was analyzed and reconstructed with Imaris ×64 9.7.1 software (Oxford Instruments). Imaris was used to analyze parameters regarding apical dendrites ...
-
No products found
because this supplier's products are not listed.
Ana Lucia Rosales Rosas, et al.,
bioRxiv - Molecular Biology 2022
Quote:
7-Deaza-2’-C-Methyladenosine (7-DMA) was purchased from Carbosynth (Berkshire, UK) and dissolved in DMSO ...
-
No products found
because this supplier's products are not listed.
Atsuko Uchida, Juan Peng, Anthony Brown,
bioRxiv - Cell Biology 2022
Quote:
... the neuronal cell culture medium was replaced with Hibernate-A medium (BrainBits, low fluorescence formulation) supplemented with 2% (v/v ...
-
No products found
because this supplier's products are not listed.
Connor D. Courtney, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and QCapture Pro 7 software (Teledyne Photometrics).
-
No products found
because this supplier's products are not listed.
Elizabeth A. Brija, et al.,
bioRxiv - Neuroscience 2023
Quote:
... In vitro kinase assays were performed using purified recombinant Cpx proteins and the catalytic subunit of CK2 (C70-10G, SignalChem). Briefly ...
-
No products found
because this supplier's products are not listed.
Büsranur Geckin, et al.,
bioRxiv - Immunology 2022
Quote:
... a 7 μM stock was used (NextFlex DNA barcodes, Bioo Scientific). First ...
-
No products found
because this supplier's products are not listed.
Assaf Alon, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Purified σ2 receptor was reconstituted into lipidic cubic phase (LCP) by mixing with a 10:1 (w:w) mix of monoolein (Hampton Research) with cholesterol (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Ben Jin, et al.,
bioRxiv - Biochemistry 2023
Quote:
... supplied with 7 ml of Dulbecco’s Modified Eagle’s Medium (Genesee, #25-500) containing 10% fetal bovine serum ...
-
No products found
because this supplier's products are not listed.
Daniel Wells, et al.,
bioRxiv - Genetics 2019
Quote:
... and the resulting immune antisera were tested against the recombinant antigen by ELISA (Eurogentec), and the endogenous protein in mouse testes from WT and KO mice (data not shown) ...
-
No products found
because this supplier's products are not listed.
Yukiko Yamaguchi, et al.,
bioRxiv - Immunology 2022
Quote:
... containing 100 U/mL recombinant human IL-2 (rhIL-2, Novartis Oncology) and 0.5 ng/mL recombinant human IL-15 (rhIL-15, CellGenix). For CAR lentiviral transduction ...
-
No products found
because this supplier's products are not listed.
Simona Selberg, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Recombinant human FTO protein was labeled with His-tag using Monolith His-Tag Labeling Kit RED-tris-NTA (NanoTemper Technologies GmbH; MO-L008). The labelled FTO protein (target ...
-
No products found
because this supplier's products are not listed.
Ji Wang, et al.,
bioRxiv - Pathology 2021
Quote:
... 5-7 μL were injected and analyzed using a hybrid 6500 QTRAP triple quadrupole mass spectrometer (AB/SCIEX) coupled to a Prominence UFLC HPLC system (Shimadzu ...