-
No products found
because this supplier's products are not listed.
Susanne N. Walker, et al.,
bioRxiv - Immunology 2020
Quote:
... Followed by capture of SARS-CoV-2 receptor binding domain which was biotinylated using the lightning-link type-A biotinylation kit(Expedeon/Abcam, 370-0005) for 180s at 10ul/min ...
-
This product is a 48.4 kDa Human CCKBR membrane protein expressed in HEK293. The protein is for...
Cat# MPC0047K,
1.0 case, Inquiry
Ask
Kylie M. Konrath, et al.,
bioRxiv - Immunology 2021
Quote:
CHO cells expressing human ACE2 receptors (VCel-Wyb030) were obtained from Creative Biolabs (Shirley, NY). CHO-ACE2 cells were seeded at 10,000 cells/well in 96-well plates and incubated for 24 hours ...
-
No products found
because this supplier's products are not listed.
Michal Schwartz, et al.,
bioRxiv - Microbiology 2022
Quote:
... using FAM labeled HCMV primer and probe: Human CMV HHV5 kit for qPCR using a glycoprotein B target (PrimerDesign); and HEX labeled RPP30 copy number assay for ddPCR (Bio-Rad) ...
-
No products found
because this supplier's products are not listed.
Chung-Ling Lu, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Anti-human procollagen type 1 antibody (LF68, ENH018) was purchased from Kerafast Inc ...
-
No products found
because this supplier's products are not listed.
Kyung-Jin Jang, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
Alpha Glutathione S-Transferase (α-GST): levels were quantified in human model effluent samples from the upper channel using an ELISA kit (DiaPharma). The assay was run following the vendor protocol using a standard curve ranging from 0-64 µg/L ...
-
No products found
because this supplier's products are not listed.
Keiji Nakamura, et al.,
bioRxiv - Microbiology 2024
Quote:
... As the ELISA kit (RIDASCREEN Verotoxin; R-Biopharm AG) became unavailable in Japan during this study ...
-
No products found
because this supplier's products are not listed.
Taewan J. Kim, et al.,
bioRxiv - Immunology 2023
Quote:
Cells were treated with Cdts and human serum type AB (Atlanta biologicals S40110; Kolkata, India) opsonized red (λEx 580nm/λEm 605nm ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Yuan Zhang, Zhigang Liu, Bin Zhang,
bioRxiv - Cell Biology 2022
Quote:
... FV antigen was quantified by ELISA using matched-pair antibody set for human FV antigen from Affinity Biologicals. All assays were performed according to manufacturers’ instructions.
-
No products found
because this supplier's products are not listed.
Estrela Neto, et al.,
bioRxiv - Cell Biology 2020
Quote:
... a multi-neurotrophin rapid screening ELISA kit (#BEK-2231, Tebu-bio, France) was used according to the manufacturers’ protocol ...
-
No products found
because this supplier's products are not listed.
Angela M. Bosco-Lauth, et al.,
bioRxiv - Microbiology 2020
Quote:
... Positive control antibodies to the receptor-binding domain (RBD) and full-length spike protein were human MAb CR3022 antibody (Absolute Antibody, Oxford UK) and human IgG whole molecule (Jackson Immuno Research ...
-
No products found
because this supplier's products are not listed.
Razieh Rafieenia, et al.,
bioRxiv - Microbiology 2022
Quote:
... Glyphosate concentrations were measured using a glyphosate ELISA kit (Abraxis, Eurofin Technologies, Hungary).
-
Gastrin Tetrapeptide (Cholecystokinin tetrapeptide, tetragastrin, CCK-4) is the C-terminal...
Cat# P1135, SKU# P1135-5mg,
5mg, $79.00
Ask
Richard Kanyo, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... Receptor inhibitors AM251 (Selleck Chemicals, Houston, TX, USA) and AM630 (Adooq Bioscience ...
-
No products found
because this supplier's products are not listed.
N.D. Maxwell, et al.,
bioRxiv - Neuroscience 2023
Quote:
... CA) using probes against the leptin receptor mRNA (Cat# 415951) and Opal 650 dye kit (Akoya Biosciences, Marlborough, MA) to label LepR mRNA ...
-
No products found
because this supplier's products are not listed.
Ethan Chervonski, et al.,
bioRxiv - Neuroscience 2020
Quote:
... CD-1 mice were injected with human adenovirus type 5 (dE1/E3) expressing mCherry protein under the control of a CMV promoter (Vector Biolabs) using either the 3D-printed or clay head mold ...
-
No products found
because this supplier's products are not listed.
Bryan J. González, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and 2 µM R428 (Tyrosine kinase receptor AXL inhibitor) (ApexBio, A8329). From d1 to d11 media was changed every day and from d12 to d27 media was changed every other day ...
-
No products found
because this supplier's products are not listed.
Yishay Wineberg, et al.,
bioRxiv - Genomics 2019
Quote:
... This was repeated in three experiments in which we used two types of RNA purification kits: the “single cell RNA Purification Kit” (51800, Norgen Biotek) was used in one experiment where we sorted 50,000 Six2-high and 50,000 Six2-low cells ...
-
No products found
because this supplier's products are not listed.
Rocher Caroline, et al.,
bioRxiv - Zoology 2020
Quote:
... or type IV collagen (Eurogentec) (1:200) ...
-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
No products found
because this supplier's products are not listed.
Matthew J. Lollar, et al.,
bioRxiv - Evolutionary Biology 2022
Quote:
... 54 g agar (Genesee Drosophila type II), 20 mL propionic acid ...
-
No products found
because this supplier's products are not listed.
Edd Ricker, et al.,
bioRxiv - Immunology 2021
Quote:
... B cell cultures were harvested at d2 and chromatin extracts were prepared using the truChIP Chromatin Shearing Reagent Kit (Covaris). 100μg of sonicated DNA protein complexes were used for immunoprecipitations with anti-IRF5 (Abcam #ab21689) ...
-
Gliadin ELISA Kit
Cat# EGLD-100,
1.0 kit, 96 tests, USD $519.0
Ask
Yehezqel Elyahu, et al.,
bioRxiv - Immunology 2024
Quote:
... The levels of AST and ALT in murine serum were measured using EnzyChrom™ ELISA kits for AST and ALT (BioAssay Systems) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Jesica Romina Canizo, et al.,
bioRxiv - Developmental Biology 2024
Quote:
E5 vitrified human embryos were thawed using a vitrification thaw kit (Irvine Scientific; 90137-SO) according to manufacturers’ recommendations ...
-
No products found
because this supplier's products are not listed.
Sorin Tanasa, et al.,
bioRxiv - Plant Biology 2022
Quote:
Meiotic buds from ∼150 inflorescences from CDKD;3:YFP and wild type control were grinded in liquid nitrogen and processed using the ChromoTek GFP-Trap® Magnetic Agarose kit (Chromotek). Briefly ...
-
No products found
because this supplier's products are not listed.
Pei Ying Ng, et al.,
bioRxiv - Cell Biology 2022
Quote:
Rabbit polyclonal anti-Cathepsin B (Atlas Antibodies, Cat#: HPA018156)
-
No products found
because this supplier's products are not listed.
Noah R. Johnson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... recombinant human Aβ40 (rPeptide), recombinant human scrambled Aβ42 (rPeptide) ...
-
No products found
because this supplier's products are not listed.
Jingxia Lu, et al.,
bioRxiv - Biochemistry 2020
Quote:
... the SpaKC sample was loaded to column B (Nanotemper MO-L011) and eluted with 450 μL of assay buffer (50mM Na2CO3/NaHCO3 ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
CUT&RUN assay libraries for cultured cells or human kidneys were generated with the CUTANA kit (EpiCypher, 14-1048). For cultured cells ...
-
No products found
because this supplier's products are not listed.
Chutima Rattanasopa, et al.,
bioRxiv - Physiology 2022
Quote:
... followed by 10 week western-type diet feeding (WTD; D12079B, Research Diets). Half the mice (assigned randomly ...
-
No products found
because this supplier's products are not listed.
Jae-Hyun Kim, et al.,
bioRxiv - Neuroscience 2020
Quote:
... depth 1.2 mm) from wild-type mice using Nanoliter 2010 injector (WPI). For anterograde trans-synaptic and retrograde tracing ...
-
No products found
because this supplier's products are not listed.
Damian Dudka, R. Brian Akins, Michael A. Lampson,
bioRxiv - Cell Biology 2023
Quote:
... Centromeres were labeled with CREST (human anti-human Anti-Centromere Antibody, 1:200, Immunovision, HCT-0100) and an Alexa Fluor 594–conjugated goat anti-human secondary antibody (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Bryan C Jensen, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The Leishmania tarentolae Parrot-TarII wild-type (WT) and T7-TR strains (Jena Bioscience) were grown in SDM-79 medium supplemented with 10% fetal bovine serum ...
-
No products found
because this supplier's products are not listed.
Matthew D. J. Dicks, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Human coagulation Factor X (hFX) (Haematologic Technologies) was added to diluted vectors at a final concentration of 8 μg/mL ...
-
No products found
because this supplier's products are not listed.
Christin Naumann, et al.,
bioRxiv - Plant Biology 2021
Quote:
... All reagents except human ceruloplasmin (Athens Research) were purchased from Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Eun Jeong Lee, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Plasma ACTH concentrations were measured using the ACTH ELISA kit (MD Biosciences), according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Nicholas J Swanson, et al.,
bioRxiv - Microbiology 2023
Quote:
... Lyophilized Receptor Destroying Enzyme II (RDE, Hardy Diagnostics) was dissolved into 20 mL of saline (0.9% NaCl in H2O ...
-
No products found
because this supplier's products are not listed.
Thomas S. Lisse,
bioRxiv - Cancer Biology 2020
Quote:
... The vitamin D receptor antagonist ZK159222 (VAZ, Toronto Research Chemicals) was reconstituted in ethanol and kept at −80°C (Ochiai E et al ...
-
No products found
because this supplier's products are not listed.
Michael J. Robertson, et al.,
bioRxiv - Biophysics 2022
Quote:
All receptors were expressed in Sf9 insect cells (Expression Systems) infected at a density of 3-4 million cells/ml ...
-
No products found
because this supplier's products are not listed.
Anna Stier, et al.,
bioRxiv - Cell Biology 2022
Quote:
... or Aurora B (SignalChem) kinases ...
-
No products found
because this supplier's products are not listed.
Aric N. Brown, et al.,
bioRxiv - Microbiology 2023
Quote:
... Polymyxin B (RPI Lot# 85594-90055) was added to cells triplicate96-well plates at a final concentration of 5.0µg/mL (C ...
-
No products found
because this supplier's products are not listed.
Mei Zhang, et al.,
bioRxiv - Neuroscience 2019
Quote:
Freshly dissected mouse brains were incubated in Golgi solution A and B (FD Rapid GolgiStain Kit, FD NeuroTechnologies) for 10 days ...
-
No products found
because this supplier's products are not listed.
Logan T. Blancett, et al.,
bioRxiv - Microbiology 2023
Quote:
... Fc receptors were blocked for 10 minutes with CD32/CD16 mAb (Leinco Technologies, Inc.). Cells were incubated with Zombie UV™ Fixable Viability Dye (BioLegend ...
-
No products found
because this supplier's products are not listed.
Jaime A. Freire-Arvelo, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Optical density of D2 receptors of each sample was obtained using Odyssey software (LI-COR Biosciences), normalized against background ...
-
No products found
because this supplier's products are not listed.
Assaf Alon, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Purified σ2 receptor was reconstituted into lipidic cubic phase (LCP) by mixing with a 10:1 (w:w) mix of monoolein (Hampton Research) with cholesterol (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
S Momsen Reincke, et al.,
bioRxiv - Immunology 2021
Quote:
... Human mAbs were applied and detected using HRP-conjugated anti-human IgG (Dianova, 709-035-149) and the HRP substrate 1-step Ultra TMB (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Salvador Dura-Bernal, et al.,
bioRxiv - Neuroscience 2022
Quote:
... We then updated the A1 connectivity of cell types that were missing from ABI V1 based on data from BBP S1 ...
-
No products found
because this supplier's products are not listed.
Paulami Dey, et al.,
bioRxiv - Biochemistry 2023
Quote:
... the samples were analysed in a triple-quadrupole type mass spectrometer (Sciex QTRAP 5500) with Schmadzu HPLC unit ...
-
No products found
because this supplier's products are not listed.
Yukiko Yamaguchi, et al.,
bioRxiv - Immunology 2022
Quote:
... containing 100 U/mL recombinant human IL-2 (rhIL-2, Novartis Oncology) and 0.5 ng/mL recombinant human IL-15 (rhIL-15, CellGenix). For CAR lentiviral transduction ...
-
No products found
because this supplier's products are not listed.
Ayşe N. Erdoğan, et al.,
bioRxiv - Evolutionary Biology 2023
Quote:
The wild-type (wt) VIM-2 gene including its signal peptide sequence was synthesized (Bio Basic Inc.) and subcloned into a low-copy number plasmid ...
-
No products found
because this supplier's products are not listed.
Andrea R. Dos Santos, et al.,
bioRxiv - Microbiology 2022
Quote:
... Citric acid kit: Citric Acid Assay Kit (Megazyme, product Code: K-CITR). Phosphate kit ...