-
No products found
because this supplier's products are not listed.
JM Robinson, et al.,
bioRxiv - Immunology 2019
Quote:
... and LBP (Human Lipopolysaccharide Binding Protein ELISA Kit, Cell Sciences, Inc., Cat# CKH113).
-
No products found
because this supplier's products are not listed.
Zhouyi Rong, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Mouse Interleukin 6 (IL6) ELISA Kit (RD-IL6-Mu, Reddot biotech), Mouse Interferon Gamma Induced Protein 10kDa (IP10 ...
-
No products found
because this supplier's products are not listed.
Matthew A. Schaller, et al.,
bioRxiv - Microbiology 2021
Quote:
... serum from humans with AB blood group (HP1022; Valley Biomedical) was added to the samples to block non-specific binding ...
-
No products found
because this supplier's products are not listed.
Yuting Zeng, et al.,
bioRxiv - Cell Biology 2022
Quote:
... The human EDN enzyme-linked immunosorbent assay (ELISA) kit (MBL International 7630, Woburn, MA) has a minimum detection limit of 0.62 ng/mL ...
-
No products found
because this supplier's products are not listed.
P. Soblechero-Martín, et al.,
bioRxiv - Neuroscience 2021
Quote:
... aiming to skip DMD exon 51 (51-[T*C*A*A*G*G*A*A*G*A*T*G*G*C*A*T*T*T*C*T]-3⍰, Eurogentec, Belgium) by transfection with Lipofectamine as described in43,44 and analysed by either myoblot (96 well plates ...
-
No products found
because this supplier's products are not listed.
Phyllis F Cheung, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Soluble PGRN levels in human plasma samples and culture supernatants were detected by a human PGRN ELISA kit (Adipogen Inc.). Please refer to the Supplementary Experimental Procedures for additional detail.
-
No products found
because this supplier's products are not listed.
Kameron Y. Sugino, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... according to the manufacturer’s protocol with 1:100 serum dilution and were analyzed for IL-6 using an old world monkey IL-6 ELISA kit (U-CyTech Biosciences, the Netherlands) according to the manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Jijin R. A. Kuttiyatveetil, et al.,
bioRxiv - Biochemistry 2021
Quote:
... ATP-FAM [g-(6-Aminohexyl)-ATP-6-FAM] was purchased from Jena Bioscience. Reactions were incubated for 30 minutes at room temperature before taking fluorescence polarization measurements on a Victor3Vplate reader (PerkinElmer) ...
-
No products found
because this supplier's products are not listed.
Ben Bar-Sadeh, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... centrifuged for 2 min at 3000 g and kept at −80 °C for measurement of GnRH in the supernatant by ELISA (Phoenix Pharmaceuticals, catalog # EK-040-02CE), according to the manufacturer’s protocol.
-
No products found
because this supplier's products are not listed.
Jia-Pu Liang, et al.,
bioRxiv - Bioengineering 2020
Quote:
... Dex ELISA kit (Cat. No. 101516; Neogen) and E2 High sensitivity ELISA kit (Cat ...
-
No products found
because this supplier's products are not listed.
Balakumaran Chandrasekar, et al.,
bioRxiv - Microbiology 2021
Quote:
... vulgare β-1,3-endoglucanase (GH17 family HvBGLUII, E-LAMHV in 50% glycerol, Megazyme). TLE or H ...
-
No products found
because this supplier's products are not listed.
Katarzyna Bogucka-Janczi, et al.,
bioRxiv - Cell Biology 2022
Quote:
... human recombinant GST-fusion ERK3 protein (SignalChem) and E.coli purified ARP3 ...
-
No products found
because this supplier's products are not listed.
Tomas Vicar, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Cells were cultivated in Flow chambers μ-Slide I Lauer Family (Ibidi, Martinsried, Germany). To maintain standard cultivation conditions (37°C ...
-
No products found
because this supplier's products are not listed.
Miriam R. Fein, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Fc receptor blocker (Innovex Biosciences), and finally avidin/biotin blocking buffer (Vector Laboratories ...
-
No products found
because this supplier's products are not listed.
Patrik Risteski, et al.,
bioRxiv - Cell Biology 2024
Quote:
... and human anti-centromere protein antibody (Antibodies Incorporated). The secondary antibodies used were donkey anti-mouse IgG-Alexa Fluor 488 (Abcam) ...
-
No products found
because this supplier's products are not listed.
Hao Yan, et al.,
bioRxiv - Cell Biology 2024
Quote:
... ELISA kits were used to measure estrogen (Calbiotech ES180S-100), progesterone (IBL America ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Jiechao Zhou, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Purified human complement proteins (4 µg/mL, Complement Technology) were immobilized and were treated with His-tagged recombinant neuronal pentraxin proteins (4 µg/mL ...
-
No products found
because this supplier's products are not listed.
Bruna Victorasso Jardim-Perassi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... a Fc receptor blocker (Tonbo Biosciences 70-0161-M001 ...
-
No products found
because this supplier's products are not listed.
Melanie Hogg, et al.,
bioRxiv - Systems Biology 2023
Quote:
... and Pancoll human (density of 1.119 g/mL and density of 1.077 g/mL) were purchased from PAN Biotech (Aidenbach, Germany). The pHrodo™ Green E ...
-
No products found
because this supplier's products are not listed.
Martin Pofahl, et al.,
bioRxiv - Neuroscience 2020
Quote:
... rAAV2/1-EF1a-DOI-eNpHR3-eYFP for experimental group) was bilaterally injected using a 34 G syringe (Nanofill Syringe, World Precision Instruments, Inc.) at a speed of 50 nl/min ...
-
No products found
because this supplier's products are not listed.
Jian Huang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... the GLUT3 protein was purified in 0.06% (w/v) 6-cyclohexyl-1-hexyl-ß-D-maltoside (Cymal-6, Anatrace) and concentrated to ~ 40 mg/ml ...
-
No products found
because this supplier's products are not listed.
Anahita Ofoghi, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... SDB-RPS cartridges (Strata™-X-C, 200 mg/6 ml, Phenomenex Inc.) were equilibrated with 8 bed volumes (BV ...
-
No products found
because this supplier's products are not listed.
Christina Grimm, et al.,
bioRxiv - Neuroscience 2021
Quote:
... averaged group and group contrast activation maps were normalized to a high-resolution Allen Brain Institute (ABI) anatomical atlas using a greedy transformation.
-
No products found
because this supplier's products are not listed.
Yash Agarwal, et al.,
bioRxiv - Immunology 2020
Quote:
... Paraffin embedded fixed sections were stained via hematoxylin and eosin or with indicated human antibodies 24 (anti-human CD45-Biocare Medical Cat. No. CME PM016AA; anti-human CD3-Biocare Medical Cat. No. CME 324 A, B, C; anti-human CD68-Biocare Medical catalog number CM 033 A ...
-
No products found
because this supplier's products are not listed.
Andrea Brenna, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Their body temperature was kept constant at 37 °C via a feedback-coupled heating device (Panlab/Harvard Apparatus), and their eyes were covered with ointment (Bepanthen Augen- und Nasensalbe ...
-
No products found
because this supplier's products are not listed.
Melissa V. Fernandez, et al.,
bioRxiv - Microbiology 2020
Quote:
... clarified cell lysates were purified by protein G affinity chromatography (Gold Biotechnology, Inc.). The b12 Fab ...
-
No products found
because this supplier's products are not listed.
Kateryna Zhalnina, et al.,
bioRxiv - Microbiology 2022
Quote:
... The samples were then centrifuged at 15000 g for 10 min and Filter Aided Sample Preparation (FASP) (65) kits were used for protein digestion (Expedeon, San Diego, CA) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Ming Liu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 48 male mice were selected at random and separated into four groups (n = 12 per group) to undergo sham or tumor cell implantation (TCI) surgery ...
-
No products found
because this supplier's products are not listed.
Qinyu Hao, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Oligonucleotides with 3’ amino group (LGC Biosearch Technologies) were pooled and coupled with either Cy®3 Mono NHS Ester (GE healthcare ...
-
No products found
because this supplier's products are not listed.
Sharon Spizzichino, et al.,
bioRxiv - Biochemistry 2021
Quote:
... BCA kit (quantumMicro Protein, EMP015480, EuroClone).
-
No products found
because this supplier's products are not listed.
Joel E. Graham, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 6 neoprene stoppers (RPI-259100-6) and capped with media bottle lid with a center bore to access the stopper ...
-
No products found
because this supplier's products are not listed.
Abigail J. D’Souza, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Protein was detected using the anti-rabbit detection kit (#DM-001, Protein Simple). Protein was quantified by area under the curve of the chemiluminescent signal ...
-
No products found
because this supplier's products are not listed.
Victoria L. Hewitt, et al.,
bioRxiv - Cell Biology 2020
Quote:
... coupled with ZEN software (Carl Zeiss) using a 100x Plan-APOCHROMAT /1.4 oil DIC objective ...
-
No products found
because this supplier's products are not listed.
Chloe R. Koulouris, et al.,
bioRxiv - Biophysics 2021
Quote:
Human malonate-bound SR was crystallised at 20 °C in 48-well MRC Maxi sittingdrop plates (Molecular Dimensions) in 25% PEG 3350 ...
-
No products found
because this supplier's products are not listed.
Marco Di Gioia, et al.,
bioRxiv - Immunology 2023
Quote:
... Total protein concentrations were determined using BCA protein assay kit (Genesee Scientific, Cat# 18-440). Proteins were separated using SDS-PAGE electrophoresis and then transferred to polyvinylidene difluoride (PVDF ...
-
No products found
because this supplier's products are not listed.
Kim T Melville, et al.,
bioRxiv - Microbiology 2023
Quote:
... Protein fluorescence was measured at 25 °C on a CLARIOstar multimode plate reader (BMG Labtech), with excitation at 295 ± 10 nm ...
-
No products found
because this supplier's products are not listed.
Yangyang Luo, et al.,
bioRxiv - Microbiology 2024
Quote:
... Then the DNA of the gut microbial samples from goats in the SSMF and FMMF groups of Nanjiang yellow goats was extracted using the OMEGA stool DNA kit (Omega Bio-Tek, the U.S). Then the quality of the DNA was assessed using 1.5% agarose gel electrophoresis ...
-
6 well glass bottom plate with high performance #1.5 cover glass (0.170±0.005mm). Black frame,...
Cat# P06-1.5H-N,
20/case, $249.00
Ask
Sandrine B. Lavenus, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 2 mL was cured overnight at 37 °C in each well of a 6-well glass bottom plate (Cellvis, Mountain View, CA). Using a biopsy punch (cat no ...
-
No products found
because this supplier's products are not listed.
Albrecht Fröhlich, et al.,
bioRxiv - Neuroscience 2022
Quote:
... RNA was extracted using the ISOLATE II RNA/DNA/Protein kit (Bioline, Germany) following the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Lars Borgards, et al.,
bioRxiv - Immunology 2023
Quote:
... The assay was performed according to the manufacturer’s instructions with a single technical replicate per sample (Uromodulin Human ELISA, BioVendor R&D, Cat. No.: RD191163200R; Azurocidin ELISA Kit, antibodies-online.com ...
-
LC Laboratories' Product Number O-6410 - Okadaic Acid, Ammonium Salt (Halochondrine A, Ammonium...
Cat# O-6410, SKU# O-6410_100ug,
100 ug, $85.00
Ask
Jacqueline M. Bliley, et al.,
bioRxiv - Bioengineering 2020
Quote:
... plus 6 µm CHIR99201 (C-6556, LC laboratories) for 48 hours ...
-
No products found
because this supplier's products are not listed.
Eugene Kim, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and for acute phase protein α-2-macroglobulin using an ELISA kit (Life Diagnostics Inc., West Chester, USA).
-
No products found
because this supplier's products are not listed.
Destiny J. Davis, et al.,
bioRxiv - Cell Biology 2020
Quote:
Cellulose was labeled with GFP-CBM3a (family 3 carbohydrate binding module; NZYtech, Lisboa, Portugal) following fixation with 1.5% PFA (PFA ...
-
No products found
because this supplier's products are not listed.
Oksana Y. Dudaryeva, et al.,
bioRxiv - Bioengineering 2021
Quote:
... by dialysis at 4 °C (1000 g mol-1 MWCO; Spectrum Laboratories), 4 times 6 h ...
-
To help researchers in the global fight against the coronavirus, abm has developed an RT-qPCR...
Cat# G628,
100 Rxns/kit, please contact supplier for pricing.
Ask
Jovino C. Cardoso, et al.,
bioRxiv - Genomics 2020
Quote:
... A group of males (blood fed, five days ABM) was dissected to obtain the testicles ...
-
No products found
because this supplier's products are not listed.
Leslie C. Rault, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... data from that test group were not used (Abbott 1925). For each treatment or control ...
-
No products found
because this supplier's products are not listed.
Hongzhuang Peng, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... The recombinant human BAP1-FL-WT protein was purchased from Boston Biochem (E-345-050). The Duet-His-ULD/AB protein complex was purified under native purification conditions using Cobalt beads (Talon) ...
-
No products found
because this supplier's products are not listed.
Paul-Christian Burda, et al.,
bioRxiv - Microbiology 2021
Quote:
... using a charge-coupled device camera (Oneview, Gatan Inc.).
-
No products found
because this supplier's products are not listed.
Nicolas Rose, et al.,
bioRxiv - Bioengineering 2021
Quote:
... PLL-g-PEG (SuSoS Technology) was added to the chip surface for 1 h and rinsed three times with Phosphate-Buffered Saline (PBS) ...