-
No products found
because this supplier's products are not listed.
Maria Hauge Pedersen, et al.,
bioRxiv - Cell Biology 2020
Quote:
... The human μ/κ/d/Nociceptin opioid receptors were all inserted into the pMEX2 vector from Multispan.
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Madeleine F. Jennewein, et al.,
bioRxiv - Immunology 2021
Quote:
To investigate Fc receptor binding recombinant Fc receptors with an AviTag were biotinylated using a Bir500 kit (Avidity, Aurora, CO, USA) according to manufacturer’s instructions and purified using a Zeba Spin Desalting Column ...
-
No products found
because this supplier's products are not listed.
Ramakanth Neeli-Venkata, et al.,
bioRxiv - Cell Biology 2020
Quote:
Cell death assays were performed on a wide-field fluorescence microscope (TI-Eclipse; Nikon) operated with Micro-Manager (Open Imaging) ...
-
No products found
because this supplier's products are not listed.
Thomas S. Lisse,
bioRxiv - Cancer Biology 2020
Quote:
... The vitamin D receptor antagonist ZK159222 (VAZ, Toronto Research Chemicals) was reconstituted in ethanol and kept at −80°C (Ochiai E et al ...
-
No products found
because this supplier's products are not listed.
Harry C. Tjondro, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Degranulated MPO (Dg-MPO) and cell death were monitored longitudinally in supernatants using ELISA (ICL LAB) and lactate dehydrogenase (LDH ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Yingying Chen, et al.,
bioRxiv - Neuroscience 2023
Quote:
... rabbit anti-immunoglobulin like domain containing receptor 1 (ILDR1) (Antibodies-online.com, 1:200, Cat # ABIN1386369), (6 ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
Jaime A. Freire-Arvelo, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Optical density of D2 receptors of each sample was obtained using Odyssey software (LI-COR Biosciences), normalized against background ...
-
No products found
because this supplier's products are not listed.
Troy T. Rohn, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or anti-5HT-2A receptor antibody (rabbit polyclonal, #24288) at 1:500 dilution (Immunostar, Hudson, WI). Secondary antibodies were conjugated to FITC or Cy3 ...
-
No products found
because this supplier's products are not listed.
Rory Henderson, et al.,
bioRxiv - Immunology 2023
Quote:
... The synthetic Toll-like receptor 7/8 agonist 3M-052 absorbed to ALUM (3M-052-ALUM) was used as the adjuvant for the vaccine immunogens ...
-
No products found
because this supplier's products are not listed.
Lanpeng Chen, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... anti-human Nanog and anti-human Oct-4 were obtained from Cell Science Signaling ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
This Fibronectin solution has been purified from human plasma where it is found as a dimer and...
Cat# 5050-1MG,
1 mg, USD $135.0
Ask
Haiqing Bai, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Human collagen-I (Advanced Biomatrix, #5007) was prepared according to manufacturer’s instruction ...
-
No products found
because this supplier's products are not listed.
Yan Tang, et al.,
bioRxiv - Cancer Biology 2022
Quote:
Human and mouse MDK ELISA assays were performed using Human Midkine ELISA Kit PicoKine™ (EK1235, BOSTER) and Mouse MDK / Midkine (Sandwich ELISA ...
-
No products found
because this supplier's products are not listed.
Tobias Tertel, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 12 nM anti-human CD63 PE (EXBIO) or 13 nM anti-human CD81 PE (Beckman Coulter) ...
-
No products found
because this supplier's products are not listed.
Thi K. Tran-Nguyen,
bioRxiv - Molecular Biology 2021
Quote:
Recombinant human GRP78s purchased from StressMarq Biosciences or produced in the laboratory [30] were used as antigens in ELISA ...
-
No products found
because this supplier's products are not listed.
Moeez Rathore, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... supplemented with 10% human serum (Atlanta Biologicals) and antibiotics-antimycotic (1x ...
-
No products found
because this supplier's products are not listed.
Thomas Keating, et al.,
bioRxiv - Immunology 2021
Quote:
... 1:500 mouse anti-human C1q (Quidel) or 1:100 mouse anti-human Ficolin-3 (Hycult ...
-
No products found
because this supplier's products are not listed.
Neuza S. Sousa, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Recombinant human MANF (P-101–100; Icosagen) was used as a standard ...
-
No products found
because this supplier's products are not listed.
Nazila V. Jafari, Jennifer L. Rohn,
bioRxiv - Microbiology 2022
Quote:
HBLAK human bladder progenitor cells (CELLnTEC, Switzerland) were grown according to the CELLnTEC protocol ...
-
No products found
because this supplier's products are not listed.
Meriem Belabed, et al.,
bioRxiv - Immunology 2023
Quote:
... anti-human CADM1 (clone 30, MBL International), anti-human CD206 (clone 15-2 ...
-
No products found
because this supplier's products are not listed.
Szymon P. Kordon, et al.,
bioRxiv - Biochemistry 2024
Quote:
Purified receptor was diluted to ∼5 ug mL−1 and applied to freshly glow-discharged EM carbon coated copper grid (Electron Microscopy Sciences, CF400-Cu,) for 30 sec ...
-
No products found
because this supplier's products are not listed.
Phyllis F Cheung, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Soluble PGRN levels in human plasma samples and culture supernatants were detected by a human PGRN ELISA kit (Adipogen Inc.). Please refer to the Supplementary Experimental Procedures for additional detail.
-
No products found
because this supplier's products are not listed.
V. Praveen Chakravarthi, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... 30 IU of human chorionic gonadotropin (hCG; BioVendor) was injected intraperitoneally ...
-
No products found
because this supplier's products are not listed.
Yuichi Mitsui, et al.,
bioRxiv - Immunology 2022
Quote:
Human PBMCs were purchased from Precision for Medicine, Inc ...
-
No products found
because this supplier's products are not listed.
Molly Ohainle, et al.,
bioRxiv - Microbiology 2019
Quote:
... supplemented with 5% heat-inactivated human AB+ serum (Omega Scientific), 20 mM GlutaMAX-I ...
-
No products found
because this supplier's products are not listed.
Huu Tuan Nguyen, et al.,
bioRxiv - Bioengineering 2023
Quote:
Human umbilical vein endothelial cells (ECs, Angio-Proteomie, MA, USA) were cultured in Vasculife (LifeLine Cell Technology ...
-
No products found
because this supplier's products are not listed.
Anna Pató, et al.,
bioRxiv - Physiology 2022
Quote:
... Human keratinocyte RNA was purified using NucleoSpin RNA (Macherey-Nagel, Düren, Germany). Before the RNA preparation ...
-
No products found
because this supplier's products are not listed.
Samuel Pazicky, et al.,
bioRxiv - Biochemistry 2021
Quote:
Parasites were cultured in 5% 0+ human erythrocytes (Blood bank, Universitätklinikum Hamburg Eppendorf) in RPMI medium supplemented with 0.5% Albumax at 37°C in an atmosphere of 1% O2 ...
-
No products found
because this supplier's products are not listed.
Ryouhei Tsutsumi, et al.,
bioRxiv - Cell Biology 2023
Quote:
... EGFP-conjugated GLUT1 ligand (receptor binding domain of the human T cell leukemiavirus (HTLV) envelope glycoprotein) was purchased from Metafora Biosystems.
-
No products found
because this supplier's products are not listed.
Bryan J. González, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and 2 µM R428 (Tyrosine kinase receptor AXL inhibitor) (ApexBio, A8329). From d1 to d11 media was changed every day and from d12 to d27 media was changed every other day ...
-
No products found
because this supplier's products are not listed.
Shirsha Saha, et al.,
bioRxiv - Biophysics 2023
Quote:
... receptor was solubilized in 0.5% L-MNG (Anatrace, Cat. no: NG310) and 0.1% cholesteryl hemisuccinate (Sigma ...
-
No products found
because this supplier's products are not listed.
N.D. Maxwell, et al.,
bioRxiv - Neuroscience 2023
Quote:
... CA) using probes against the leptin receptor mRNA (Cat# 415951) and Opal 650 dye kit (Akoya Biosciences, Marlborough, MA) to label LepR mRNA ...
-
No products found
because this supplier's products are not listed.
Holger Dill, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Staining of acetylcholine receptors was performed with 10 µg/ml CF®488A conjugated α-Bungarotoxin (Biotrend, Cologne, Germany) in PBST complemented with 10% FCS and 1% DMSO.
-
No products found
because this supplier's products are not listed.
Tracy J. Berg, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... Primary human astrocytes (3H Biomedical) were cultured in Astrocyte Medium (3H Biomedical ...
-
No products found
because this supplier's products are not listed.
Jing Fan, et al.,
bioRxiv - Cell Biology 2023
Quote:
... PAR (Trevigen and human #19) or magnetic beads conjugated with anti-Flag antibody (Sigma) ...
-
No products found
because this supplier's products are not listed.
Sandrine Huot, et al.,
bioRxiv - Immunology 2020
Quote:
... Human MPO and human Lactoferrin ELISA kits were purchased from Assaypro (St. Charles, MO, USA). MMP-9 Duoset ELISA was obtained from R&D Systems ...
-
No products found
because this supplier's products are not listed.
S.G. Badman, et al.,
bioRxiv - Microbiology 2020
Quote:
... Human genomic DNA purchased from Bioline Australia (Cat No ...
-
No products found
because this supplier's products are not listed.
Antje Neeb, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... panBAG-1 (human, rabbit monoclonal, RM356, RevMAb), panBAG-1 (mouse ...
-
No products found
because this supplier's products are not listed.
Chenchen Mao, et al.,
bioRxiv - Immunology 2024
Quote:
... The Human SCF ELISA kit (Solarbio, China) was used according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Ava P. Soleimany, et al.,
bioRxiv - Bioengineering 2020
Quote:
Fresh frozen human PCa TMAs (BioChain Institute, Inc.; T6235201) were air dried and fixed in ice-cold acetone for 10 minutes ...
-
No products found
Madeline G. Andrews, et al.,
bioRxiv - Neuroscience 2020
Quote:
Primary human cortical tissue was dissociated with Papain (Worthington)-containing DNase ...
-
No products found
because this supplier's products are not listed.
Leslie E. Lupien, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... human DiI-VLDLs (1 mg protein/mL; Alfa Aesar Chemicals), LPL from bovine milk (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Mutsumi Kobayashi, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Human iPSCs were dissociated using Accutase (Innovative Cell Technologies, AT104) and suspended in mTeSR plus (Stemcell Technologies ...
-
No products found
because this supplier's products are not listed.
JM Robinson, et al.,
bioRxiv - Immunology 2019
Quote:
... I-FABP (Human I-FABP ELISA Kit, Hycult biotech, Cat# HK406), and LBP (Human Lipopolysaccharide Binding Protein ELISA Kit ...
-
No products found
because this supplier's products are not listed.
Jeanette M. Metzger, et al.,
bioRxiv - Neuroscience 2022
Quote:
GFP-expressing human embryonic kidney cells (i.e., GFP-HEK cells, GenTarget Inc.) were used as an RNP delivery cell model ...
-
No products found
because this supplier's products are not listed.
Filippo Spriano, et al.,
bioRxiv - Cancer Biology 2023
Quote:
The Quantum Simply Cellular (QSC) anti-Human IgG beads from Bangs Laboratories were utilized to establish a calibration curve for determining the absolute CD25 surface expression ...