-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
No products found
because this supplier's products are not listed.
Leslie E. Lupien, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... human DiI-VLDLs (1 mg protein/mL; Alfa Aesar Chemicals), LPL from bovine milk (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Hajera Amatullah, et al.,
bioRxiv - Immunology 2021
Quote:
Full length human recombinant SP140 protein was commercially produced by BPS Bioscience using a HEK293T expression system ...
-
Recombinant Human BMP2 protein was expressed in Escherichia coli.
Cat# BMP2-01H,
50ug , USD $298
Ask
Paramita Ray, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... The human recombinant SMURF2 protein (Cat. 468H, Creative Biomart, New York, NY) and different EGFR (WT ...
-
No products found
because this supplier's products are not listed.
Emily Lorenzen, et al.,
bioRxiv - Biochemistry 2019
Quote:
... HPA Abs from the Human Protein Atlas are commercially available from Atlas Antibodies AB ...
-
No products found
because this supplier's products are not listed.
Genshen Zhong, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Then human ID2 protein (Cat#PROTQ02363, purchased from Boster Biological Technology Co. Ltd, China.) was diluted to 50 μg/mL with fixative reagent (10 mM sodium acetate ...
-
No products found
because this supplier's products are not listed.
E.J. Davies, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Estrogen Receptor (clone 6F11, 1:500, #VP-E613, Vector Labs, Peterborough, UK), Progesterone Receptor (clone hPRa7 ...
-
No products found
because this supplier's products are not listed.
Hadeel Alyenbaawi, et al.,
bioRxiv - Neuroscience 2020
Quote:
Synthetic human tau protein (wildtype full-length monomers) was purchased as a lyophilized powder (rPeptide, T-1001-2) and resuspended in ddH2O at a concentration of 2mg/ml ...
-
No products found
because this supplier's products are not listed.
Lily E. Adams, et al.,
bioRxiv - Microbiology 2022
Quote:
... and 1:750 for Fcγ-receptor binding) in a 384-well plate (Greiner, Germany) overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
M. Fenu, et al.,
bioRxiv - Biophysics 2023
Quote:
... human fibrinogen (Enzyme Research Laboratories, plasma purified ...
-
No products found
because this supplier's products are not listed.
Damon A. Hofman, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... human EGF (20ng/mL; Shenandoah Biotech), human FGF-basic-154 (20ng/mL ...
-
No products found
because this supplier's products are not listed.
Michał A. Surma, et al.,
bioRxiv - Biochemistry 2021
Quote:
... healthy diets differing by protein content: Teklad global 14% protein (Envigo #2014S, low protein) and Teklad global 18% protein (Envigo #2018S ...
-
No products found
because this supplier's products are not listed.
S. Jordan Kerns, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Human alveolar epithelial cells (Cell Biologics, Accegen) were cultured using SABM medium (Lonza ...
-
No products found
Katharina M. Eyme, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... human recombinant EGF (20 ng/mL; ABM), and human recombinant bFGF-2 (10ng/mL ...
-
No products found
because this supplier's products are not listed.
Stefanie Krug, et al.,
bioRxiv - Immunology 2021
Quote:
... Protein concentrations were determined by CB-X protein assay (G-Biosciences) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Chang-Hoon Kim, et al.,
bioRxiv - Molecular Biology 2021
Quote:
Recombinant Flag-tagged human G9a (Active Motif, 31410), human calpain 1 (Novus ...
-
CSC 2F0 cells were isolated by centrifugal counterflow elutriation from 250 individual donor...
Cat# CSC 2F0 V,
1.0 Units, $405.0
Ask
Changsheng Chen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Human umbilical vein endothelial cells (HUVECs, Cell System) were cultured in endothelial cell growth medium according to the protocol provided by the manufacturer (VascuLife ...
-
No products found
because this supplier's products are not listed.
How-Wing Leung, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Total protein was isolated using an RNA-protein extraction kit (Macherey-Nagel), as specified by the manufacturer ...
-
No products found
because this supplier's products are not listed.
David Gonzalez-Perez, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Proteins were separated by SDS-PAGE (12% Mini-PROTEAN TGX Precast Protein Gels, Bio-Rad) and transferred to PVDF membranes using an iBlot2 Gel Transfer Device (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Luana dos Santos Ortolan, et al.,
bioRxiv - Pathology 2019
Quote:
Soluble endothelial protein C receptor (sEPCR) was measured with an ELISA kit (Elabscience®, E-EL-M1073) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Susanne Hellmuth, Olaf Stemmann,
bioRxiv - Cell Biology 2024
Quote:
... raised against CAKSKAKPPKGAHVEV = Cys + amino acids 1183-1197 of the human protein) and human anti-CREST (1:1,000; hct-0100, ImmunoVision). Secondary antibodies (all 1:500) ...
-
No products found
because this supplier's products are not listed.
Lijin Zou, et al.,
bioRxiv - Synthetic Biology 2020
Quote:
... The human proteins were assigned to 3 Piggybac vectors (System Biosciences, USA) by Golden Gate Assembly method (11 ...
-
No products found
because this supplier's products are not listed.
Michael J. Robertson, et al.,
bioRxiv - Biophysics 2022
Quote:
All receptors were expressed in Sf9 insect cells (Expression Systems) infected at a density of 3-4 million cells/ml ...
-
No products found
because this supplier's products are not listed.
Yan Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or anti-PAC1 receptor (1:50 dilution, LifeSpan BioSciences, Inc.) at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Tai L. Ng, et al.,
bioRxiv - Systems Biology 2021
Quote:
... torque teno virus hypothetical protein or human respirovirus 3 D protein were transfected into the cells using TransIT-LT1 (Mirus Bio) according to manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Shirsha Saha, et al.,
bioRxiv - Biophysics 2023
Quote:
... receptor was solubilized in 0.5% L-MNG (Anatrace, Cat. no: NG310) and 0.1% cholesteryl hemisuccinate (Sigma ...
-
No products found
because this supplier's products are not listed.
Joseph M. Autry, et al.,
bioRxiv - Biochemistry 2019
Quote:
Anti-human-SLN bs-9855R is a rabbit pAb IgG purified by protein A chromatography (Bioss, Inc.). The immunogen was synthetic human SLN (residues 1–31 ...
-
No products found
because this supplier's products are not listed.
Vidyanand Anaparti, et al.,
bioRxiv - Physiology 2019
Quote:
... C-reactive protein (CRP) levels were measured using a human high-sensitivity CRP (hs-CRP) ELISA kit (Biomatik, Canada) as per the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Meng Zhang, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Fluorescence intensity of Tb3+-labelled receptors was measured on an Infinite M1000 fluorescence plate reader (Tecan) with an excitation wavelength of 340 nm and emission wavelength of 620 nm ...
-
No products found
because this supplier's products are not listed.
S. Venkatesan, et al.,
bioRxiv - Neuroscience 2022
Quote:
... The NMDA receptor–mediated eEPSCs were analyzed as an average of 3 traces with Clampfit (Molecular Devices) and D-APV (50 μM ...
-
No products found
because this supplier's products are not listed.
Yash Agarwal, et al.,
bioRxiv - Immunology 2020
Quote:
... Paraffin embedded fixed sections were stained via hematoxylin and eosin or with indicated human antibodies 24 (anti-human CD45-Biocare Medical Cat. No. CME PM016AA; anti-human CD3-Biocare Medical Cat ...
-
No products found
because this supplier's products are not listed.
Jan Steinkühler, et al.,
bioRxiv - Biophysics 2020
Quote:
... Human Transferrin – CF488A (Biotium) at 130 nM ...
-
No products found
because this supplier's products are not listed.
Marina Boudigou, et al.,
bioRxiv - Immunology 2021
Quote:
... Pancoll human (PAN Biotech). CD19+ B cells were purified from human PBMCs using the REAlease® CD19 Microbead Kit (Miltenyi Biotec ...
-
No products found
because this supplier's products are not listed.
Aum R. Patel, et al.,
bioRxiv - Microbiology 2021
Quote:
Normal Adult Human Dermal Fibroblasts and Normal Human Skeletal Muscle Satellite Cells (SkMc) (Lifeline Cell Technologies, USA) were cultured using FibroLife S2 Medium and StemLife SK Medium ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Katharina Hoette, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Isolation of organoids from the embedding matrix (human hepatic organoids: Matrigel, Corning; human pancreatic organoids: Cultrex BME2, Amsbio) for fixation and whole-mount staining was performed with slight modifications of protocols published by Broutier et al ...
-
No products found
because this supplier's products are not listed.
Baishakhi Ghosh, et al.,
bioRxiv - Cell Biology 2021
Quote:
Primary non-diseased human bronchial epithelial (NHBE) and COPD human bronchial epithelial (CHBE) cells were purchased from MatTek Life Sciences (Ashland ...
-
No products found
because this supplier's products are not listed.
Joelle P. Straehla, et al.,
bioRxiv - Bioengineering 2021
Quote:
Human iPS-ECs (Fujifilm Cellular Dynamics, 11713), human brain PCs and ACs (ScienCell) ...
-
No products found
because this supplier's products are not listed.
Ricardo da Silva Antunes, et al.,
bioRxiv - Immunology 2023
Quote:
... in 5% human serum (Gemini Bio-Products) for 24 h ...
-
No products found
because this supplier's products are not listed.
Eleanor M Denham, et al.,
bioRxiv - Immunology 2019
Quote:
Cells were analysed for receptor surface expression by flow cytometry using anti-Strep-tag II antibody Oyster 645 (IBA Lifesciences # 2-1555-050), or anti-Strep-tag II antibody (IBA Lifesciences # 2-1507-001 ...
-
No products found
because this supplier's products are not listed.
Lei Zhang, José M Jiménez-Gómez,
bioRxiv - Plant Biology 2019
Quote:
... Total protein was extracted using PEB protein extraction buffer (Agrisera Antibodies) according to the manufacturer‘s instructions ...
-
No products found
because this supplier's products are not listed.
Michael M. Lutz, et al.,
bioRxiv - Microbiology 2019
Quote:
... Human Pancreatic Ductal Epithelial (HPDE) cells (Kerafast H6c7) were maintained in keratinocyte SFM (serum-free medium ...
-
No products found
because this supplier's products are not listed.
Ling Ning Lam, et al.,
bioRxiv - Microbiology 2021
Quote:
... and inoculated at a ratio of 1:1000 into pooled human serum or pooled human urine (both purchased from Lee Biosolutions). At selected time points ...
-
No products found
because this supplier's products are not listed.
Hui Chen, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... The proteins were first purified using CaptivA Protein A affinity resin (Repligen), unless otherwise specified ...
-
No products found
because this supplier's products are not listed.
Jürgen G. Okun, et al.,
bioRxiv - Physiology 2020
Quote:
... or protein-enriched (80%E protein, 10% carbohydrate, 10% fat; D16080303, Research Diets, USA) diets for a period of 3 weeks with various metabolic phenotyping tests ...
-
No products found
because this supplier's products are not listed.
Blagoje Soskic, et al.,
bioRxiv - Genetics 2019
Quote:
... we used ChIP grade antibodies specific to human H3K27ac histones (Diagenode). A negative control undergoing no IP (input ...
-
No products found
because this supplier's products are not listed.
Indira Wu, Hee Shin Kim, Tuval Ben-Yehezkel,
bioRxiv - Genomics 2019
Quote:
... while human liver total RNA and human blood total RNA were purchased from Zyagen. LoopSeq Transcriptome kit was obtained from Loop Genomics ...
-
No products found
because this supplier's products are not listed.
Matthew D. J. Dicks, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Human coagulation Factor X (hFX) (Haematologic Technologies) was added to diluted vectors at a final concentration of 8 μg/mL ...
-
No products found
because this supplier's products are not listed.
Jianfang Li, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Human C-peptide levels in isolated plasma were quantified using the STELLUX Chemi Human C-peptide ELISA kit (ALPCO Diagnostics) according to the manufacturer’s instructions.