-
No products found
because this supplier's products are not listed.
Aleksei Kuznetsov, et al.,
bioRxiv - Biochemistry 2020
Quote:
Human recombinant ACE2-His protein (Icosagen OÜ, Estonia, cat# P-302-100) and SARS-CoV-2 Spike protein S1 (Icosagen OÜ ...
-
Cat# B23202, SKU# B23202-5 ml,
5 ml, $306.00
Ask
Xuxiao He, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... and Nickel Magnetic Beads for His tag protein purification (Bimake, B23602) according to the manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Meenakshi Basu Shrivastava, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 500 ng human recombinant His-tagged ubiquitin-conjugating enzyme (E2) Ube2d3 (from BIOMOL International, #U0880), in the presence or the absence of 10 μg N-terminal-His-tagged ubiquitin (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Eric M. Patrick, et al.,
bioRxiv - Biochemistry 2019
Quote:
... prior to binding of the complex to 1 μM diameter polystyrene beads (Spherotech) functionalized with an anti-digoxigenin antibody (Roche ...
-
No products found
because this supplier's products are not listed.
Justine Creff, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 200 µg for HEK293) were incubated with 3 µg of the indicated antibodies and 12 µL protein sepharose beads (IPA300, Repligen) at 4°C for 4 h ...
-
No products found
because this supplier's products are not listed.
Simon J. Cleary, et al.,
bioRxiv - Immunology 2024
Quote:
... These sequences were codon-optimized and antibodies were expressed as chimeric hIgG1 with or without Fc point mutations in a HEK293 cell system and purified using protein A and buffer exchange (Absolute Antibody).
-
No products found
because this supplier's products are not listed.
Julian A. Harris, et al.,
bioRxiv - Biochemistry 2021
Quote:
... A single bicistronic baculovirus encoding the human Gβ1 subunit with a N-terminal 6x His-tag and rhinovirus 3C protease site and untagged human Gγ2 subunit was generated using the BestBac method (Expression systems) in Spodoptera frugiperda (Sf9 ...
-
No products found
because this supplier's products are not listed.
Rayan Khaddaj-Mallat, et al.,
bioRxiv - Neuroscience 2021
Quote:
... The levels of S protein in different brain regions upon its intranasal infusion were measured using His-Tag protein ELISA kit that allows detection and quantification of poly-histidine-tagged proteins in a biological sample (Cell Biolabs Inc., CA, USA). The experimental procedure was performed as recommended by the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Shubhi Pandey, et al.,
bioRxiv - Biochemistry 2021
Quote:
... 3.5 μl of the protein complex was applied onto glow discharged formvar/carbon coated 300 mesh copper grids (PELCO, Ted Pella) and blotted off after adsorption of the sample for 1 min using a filter paper ...
-
No products found
because this supplier's products are not listed.
Beatrice Senigagliesi, et al.,
bioRxiv - Biophysics 2022
Quote:
... Incubation for 10 minutes led to a stable protein–dye complex that was monitored at 595 nm using a spectrophotometer TECAN infinite F200 PRO (Tecan Trading AG, Switzerland). The vesicle protein amount was calculated using a BSA calibration curve in a range of 0.05–2 mg/mL ...
-
Cat# HY-P70395-50 μg,
50 μg, USD $285.0
Ask
Huan Wang, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Teriparatide (Human parathyroid hormone-(1-34)) (MedChemExpress), Glu (Sigma-Aldrich) ...
-
No products found
because this supplier's products are not listed.
Naoya Kase, et al.,
bioRxiv - Immunology 2020
Quote:
... and the Human CCL2 (MCP-1) Kit (62HCCL2PEG; Cisbio) or Human CXCL10 (IP-10 ...
-
No products found
because this supplier's products are not listed.
Evangelos Stefanidis, et al.,
bioRxiv - Bioengineering 2023
Quote:
... 1% Penicillin/Streptomycin and 50ng/ml human M-CSF (ImmunoTools) for 7 days and harvesting the adherent fraction ...
-
No products found
because this supplier's products are not listed.
Chung-Ling Lu, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Anti-human procollagen type 1 antibody (LF68, ENH018) was purchased from Kerafast Inc ...
-
No products found
because this supplier's products are not listed.
Patrick J. Ferrara, et al.,
bioRxiv - Physiology 2022
Quote:
... and uncoupling protein-1 (UCP1: Alpha Diagnostic UCP11-A).
-
No products found
because this supplier's products are not listed.
Kevin P. Foley, et al.,
bioRxiv - Physiology 2020
Quote:
... Human insulin (Mercodia) and human C-peptide (Millipore ...
-
No products found
because this supplier's products are not listed.
Redouane Aherrahrou, et al.,
bioRxiv - Genetics 2023
Quote:
... Human aortic SMCs (Cell Applications, Inc. ...
-
This mRNA encodes a Human antibody against WT-1/HLA/A2. It contains two mRNAs that encode for...
Cat# Gly-057LC-mRNA,
Inquiry
Ask
Xiaotian Tan, et al.,
bioRxiv - Bioengineering 2020
Quote:
... The human-cell-expressed SARS-CoV Spike S1-His recombinant protein was purchased from Creative Biolabs (VAng-Wyb7337). The recombinant CR3022 therapeutic antibody was purchased from Creative Biolabs (MRO-1214LC) ...
-
No products found
because this supplier's products are not listed.
Anil Verma, et al.,
bioRxiv - Immunology 2023
Quote:
... were labeled with biotinylated anti-His tag monoclonal antibody (ThermoScientific) and used to capture His-tagged clade C gp120 Du151 protein (Immune Technologies). The gp120-expressing beads were then incubated with triplicate 5-fold dilutions of heat-inactivated serum samples in V-bottom plates for 1h at 37°C ...
-
No products found
because this supplier's products are not listed.
Frederik Fleissner, et al.,
bioRxiv - Biophysics 2020
Quote:
A plasmid coding for human vimentin containing a C-terminal His-tag (EX-D0114-B31, Tebu-bio, Germany) was transformed into E ...
-
No products found
because this supplier's products are not listed.
Mengyue Lv, et al.,
bioRxiv - Cancer Biology 2021
Quote:
The RM-1 cells of 1×107 WT and Mettl9 KO were extracted with TRNzol (TIANGEN) for total RNA library preparation ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Lyra O. Randzavola, et al.,
bioRxiv - Immunology 2022
Quote:
... HEK293-F were transfected with polyethylenimine (Polyscience Europe GmbH) at a ratio of 1:3 DNA:polyethylenimine (Tom et al. ...
-
No products found
because this supplier's products are not listed.
Ying-Feng Zheng, et al.,
bioRxiv - Genomics 2020
Quote:
... US).Library complex wasthen sequenced using SMRT Cell 8M (PacBio)compatible with the Sequel II sequencer.
-
No products found
because this supplier's products are not listed.
Masaki Okumura, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Insulin complex images were recorded with a K3 camera (Gatan) as movie micrographs at the total electron exposure on the specimen was around 80e-Å−2 and the nominal magnification at 60,000 ...
-
No products found
because this supplier's products are not listed.
Cody Juguilon, et al.,
bioRxiv - Physiology 2021
Quote:
Different lot numbers of WT and db/db mouse coronary endothelial cells (WT and db/db mCEC) were purchased from Cell Biologics; healthy human and diabetic patient coronary artery endothelial cells (Healthy and Diabetic hCEC ...
-
No products found
because this supplier's products are not listed.
Norie Sugitani, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... supplemented with 1 µM human gp100 (25-33) (Eurogentec) and 50 U/mL IL-2 (PeproTech ...
-
No products found
because this supplier's products are not listed.
Cheyenne Hurst, et al.,
bioRxiv - Neuroscience 2022
Quote:
... recombinant human Aβ42 (5 μM) (rPeptide, # A-1170-1) was handled essentially as described (67 ...
-
No products found
because this supplier's products are not listed.
Camilla Kjeldgaard Larsen, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... The cleaved proteins were incubated with Ni-NTA beads for revers his-purification and cleaved proteins were collected in the flow through and visualized on SDS-PAGE (Mini Protean Tris-Tricine Precast gels, BioRad).
-
No products found
because this supplier's products are not listed.
Cansu Koyunlar, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... gfi1b construct and mRNA transposase were co-injected to the single cell of WT(CD41:GFP) or gata2b-/-(CD41:GFP) zebrafish embryos at 1-cell stage using PV830 Pneumatic PicoPump (WPI). Embryos were anesthetized using 160 mg/L Tricaine (Sigma ...
-
No products found
because this supplier's products are not listed.
Su-Hyeong Kim, et al.,
bioRxiv - Cancer Biology 2020
Quote:
Expression of FoxQ1 protein in tissue microarrays of human luminal-type breast cancers (US Biomax, Rockville, MD; catalog # BR1508) and normal human mammary tissues (US Biomax ...
-
No products found
because this supplier's products are not listed.
Hongwen Chen, et al.,
bioRxiv - Biophysics 2023
Quote:
... and the complex was eluted with 5 CVs of 3×Flag peptide (0.1 mg/ml; ApexBio). The eluted protein was further purified by gel filtration using a Superose 6 Increase 10/300 GL column (Cytiva ...
-
No products found
because this supplier's products are not listed.
Prasanna Babu Araveti, et al.,
bioRxiv - Microbiology 2022
Quote:
... the fluorescence images of the HEK293 cells were captured using Axio Observer 7 microscope Apotome 2 (Carl Zeiss).
-
No products found
because this supplier's products are not listed.
Oluwadamilola O. Lawal, et al.,
bioRxiv - Neuroscience 2024
Quote:
... chicken anti-green fluorescent protein (1:1000 [GFP-1020, Aves Labs, CA]), Guinea pig anti-VGAT (Synaptic Systems #131004) ...
-
No products found
because this supplier's products are not listed.
Bjoern Traenkle, et al.,
bioRxiv - Immunology 2021
Quote:
... an alpaca (Vicugna pacos) was immunized with the purified extracellular domains of human CD4 (aa26-390) recombinantly produced in HEK293 cells (antibodies-online GmbH, Germany). After initial priming with 1 mg ...
-
No products found
because this supplier's products are not listed.
F.M. Elahi, et al.,
bioRxiv - Neuroscience 2019
Quote:
... terminal complement complex C5b-C9 (Elabscience, Bethesda, MD), CD59 and mannose-binding lectin (MBL ...
-
This tropoelastin is produced using recombinant production methods. The tropoelastin is supplied...
Cat# 5052-1MG,
1 mg, USD $375.0
Ask
Ines A Cadena, et al.,
bioRxiv - Bioengineering 2024
Quote:
... human (1 mg/mL, Advanced Biomatrix) and either GelMA (8.7% v/w ...
-
No products found
because this supplier's products are not listed.
KM Hudock, et al.,
bioRxiv - Immunology 2022
Quote:
... 100mU/ml human NE protein (Athens Research & Technology #16-14-051200, ART), 100μU/ml human PR3 protein (ART #16-14-161820 ...
-
No products found
because this supplier's products are not listed.
Kenneth H. Dinnon III, et al.,
bioRxiv - Microbiology 2022
Quote:
... prior to instilling 0.5 mL of 1% (wt/vol) low melting agarose (Amresco, Solon, OH), similar to previous protocols (78) ...
-
No products found
because this supplier's products are not listed.
Heather Schiller, et al.,
bioRxiv - Microbiology 2023
Quote:
... 1-in orbital diameter) or on solid agar (containing 1.5% [wt/vol] agar) NZCYM (RPI) medium ...
-
No products found
because this supplier's products are not listed.
Emily A. Hemann, et al.,
bioRxiv - Immunology 2022
Quote:
PBMCs from healthy HLA-A0201+ individuals were cultured in Cell Gro DC medium (CellGenix) supplemented for GM-CSF and IL-4 to induce DC differentiation ...
-
No products found
because this supplier's products are not listed.
Pavel Shekhtmeyster, et al.,
bioRxiv - Neuroscience 2021
Quote:
... This vector was co-transfected into HEK293-AAV cells (Vector Biolabs) along with a pAdeno-helper vector and a pRC-AAV9 rep-cap plasmid ...
-
No products found
because this supplier's products are not listed.
Sara Hernández-Pérez, et al.,
bioRxiv - Immunology 2023
Quote:
... groups of WT (CD19WT/WT Rab8aflox/flox) and Rab8a-/- (CD19WT/Cre Rab8aflox/flox) females were immunised with NP40-FICOLL (F-1420, Biosearch Technologies) or NP-LPS (N-5065 ...
-
Anti-HLA-DR (IMMU-114) is a humanized anti-human leukocyte antigen-DR (HLA-DR) moAb, that...
Cat# A2465, SKU# A2465-1mg*25,
1mg*25, $5070.00
Ask
Allen L. Pan, et al.,
bioRxiv - Neuroscience 2023
Quote:
... human SCF (20 ng/mL) and 10 μM Rho-associated protein kinase inhibitor (ROCKi, Selleck Chemicals). Embryoid bodies were fed every day from day 1 to day 3 ...
-
No products found
because this supplier's products are not listed.
Ling Ning Lam, et al.,
bioRxiv - Microbiology 2021
Quote:
... and inoculated at a ratio of 1:1000 into pooled human serum or pooled human urine (both purchased from Lee Biosolutions). At selected time points ...
-
No products found
because this supplier's products are not listed.
Bruce Campbell, Patricia Bourassa, Robert Aiello,
bioRxiv - Pathology 2021
Quote:
... WT mice were maintained on a normal murine diet (Research Diets, Inc., New Brunswick, NJ). The ethics committee at Mount Sinai approved all of the animal experiments ...
-
No products found
because this supplier's products are not listed.
Sumona P. Dhara, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Reactions were quenched in heat inactivated fetal calf serum (HI-FCS; Gemini Bio-Products) in DMEM/F12 (Gibco ...
-
No products found
because this supplier's products are not listed.
Damon A. Hofman, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... human EGF (20ng/mL; Shenandoah Biotech), human FGF-basic-154 (20ng/mL ...
-
No products found
because this supplier's products are not listed.
Diego Gilioli, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 10% Human Serum (cat#ECS0219D from Euroclone) and IL-2 (cat#F027131010 from Novartis ...
-
PRG-1 (EDTA -dPBS Solution) prepares the cells for PRG-2 (containing Trypsin) processing. Cell...
Cat# 4Z0-610,
100.0 mL, $68.0
Ask
Changsheng Chen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Human retinal microvascular endothelial cells (HRMECs, Cell System) were cultured in a complete classic medium supplemented with/without high-content glucose (50 or 100 mM) ...