-
No products found
because this supplier's products are not listed.
Shawna K. Brookens, et al.,
bioRxiv - Immunology 2023
Quote:
... were coated with anti-Ig(H+L) (Biosearch Technologies) prior to culture [20 hr ...
-
No products found
because this supplier's products are not listed.
Takuma Asahi, et al.,
bioRxiv - Immunology 2022
Quote:
... rabbit polyclonal IgG anti-LYVE-1 (RELIATech, Braunschweig, Germany), and goat polyclonal IgG anti-NKp46 (R&D ...
-
No products found
because this supplier's products are not listed.
Tetsuro Yamamoto, et al.,
bioRxiv - Immunology 2023
Quote:
... HRP-human IgG antibody (EY Laboratories, USA), and BT IgE antibody (Bio-Rad Laboratories ...
-
No products found
because this supplier's products are not listed.
Briana A. Santo, et al.,
bioRxiv - Pathology 2021
Quote:
... followed by HRP Unovue Rabbit HRP detection reagent (RU-HRP1000, Diagnostic BioSystems, Pleasanton, CA) and exposed to diaminobenzidine (DAB ...
-
No products found
because this supplier's products are not listed.
Tristan Frum, Amy Ralston,
bioRxiv - Developmental Biology 2020
Quote:
... Primary antibodies were diluted in blocking buffer to the following concentrations: rabbit IgG anti-Nanog (Reprocell, RCAB002P) 1:400 ...
-
No products found
because this supplier's products are not listed.
Evgeniia N. Bykonia, et al.,
bioRxiv - Immunology 2024
Quote:
... Plates were washed 3 times and incubated with 100 μL HRP-conjugated anti-mouse IgG secondary antibody (L20/01; HyTest; 1:25000) for 1 hour at 37°C ...
-
No products found
because this supplier's products are not listed.
Nikolai P. Melnikov, et al.,
bioRxiv - Zoology 2021
Quote:
... 561 nm (EdU + Sulfo-Cyanine3 Azide) and 648 nm (Rabbit Anti-phospho-histone H3 ABI + DAR IgG Alexa Fluor 647). All Z-stacks were obtained with a 1-μm Z-step ...
-
No products found
because this supplier's products are not listed.
Shijie Cao, et al.,
bioRxiv - Bioengineering 2023
Quote:
... and plasma was analyzed for anti-OVA total IgG antibodies using a mouse anti-OVA IgG antibody assay kit (Chondrex). On day 13 ...
-
No products found
because this supplier's products are not listed.
Natalie S. Haddad, et al.,
bioRxiv - Immunology 2020
Quote:
... InvivoGen) and 6G9 (human:mouse chimeric IgG anti-N; Amsbio) were used as calibrators for SARS-CoV-2 antibody concentrations.
-
No products found
because this supplier's products are not listed.
Yoko Miura, et al.,
bioRxiv - Pathology 2021
Quote:
... rabbit anti-SP-C (Hycult Biotech), rat anti-Podoplanin (MBL) ...
-
No products found
because this supplier's products are not listed.
Jie Wang, Amir Rattner, Jeremy Nathans,
bioRxiv - Immunology 2023
Quote:
... rabbit anti-COL25A1 (G-Biosciences ITT1021); goat anti-IGSF8 (R&D systems AF3117-SP) ...
-
No products found
because this supplier's products are not listed.
Nathan A. Ewing-Crystal, et al.,
bioRxiv - Immunology 2024
Quote:
... goat anti-Desmin (GenWay Biotech GWB-EV0472, 1:200), goat anti-Decorin (Novus Biologicals AF1060 ...
-
No products found
because this supplier's products are not listed.
Andrés de la Rocha-Muñoz, et al.,
bioRxiv - Neuroscience 2021
Quote:
... rabbit anti-calnexin (StressMarq Biosciences, SPC-108), mouse anti-calnexin (BD Transduction Laboratories ...
-
No products found
because this supplier's products are not listed.
Besir Krasniqi, et al.,
bioRxiv - Microbiology 2020
Quote:
... 1 h incubation was done with mouse monoclonal anti-dsRNA antibody (J2, SCICONS English & Scientific Consulting Kft ...
-
Goat Liver Powder Extract is derived from Goat liver.
Cat# E3803, SKU# E3803-5mg,
5mg, $89.00
Ask
Mauro Rosales, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 200 µL/well) and 24 h later serial dilutions 1:2 ranging from 50-1.6 µM of CX-4945 (Selleck Chemicals, TX, USA) were added ...
-
Cat# FL-04,
500 micrograms,USD $303.0
Ask
Shai Sabbah, et al.,
bioRxiv - Neuroscience 2022
Quote:
... rabbit anti-melanopsin (1:1000, Advanced Targeting Systems); or 4 ...
-
No products found
because this supplier's products are not listed.
Justinn Barr, et al.,
bioRxiv - Cell Biology 2022
Quote:
... rabbit anti-Pro-SPC (Seven Hills Bioreagents, WRAB-9337). Secondary antibodies used ...
-
No products found
because this supplier's products are not listed.
Philip Dettinger, et al.,
bioRxiv - Bioengineering 2021
Quote:
... slides coated for 1 h with 10 µg/mL anti-CD43-biotin (MEM-59, ExBio) in PBS ...
-
No products found
because this supplier's products are not listed.
Ronan W. O’Connell, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... 2 mM L-Alanyl-L-Glutamine (Caisson labs, GLL02), referred to hereafter as complete DMEM ...
-
No products found
because this supplier's products are not listed.
Dhanushan Wijayaratna, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Coelentrazine-H (AAT Bioquest). Stock solutions of compounds were prepared according to manufacturers’ recommendations ...
-
No products found
because this supplier's products are not listed.
Xiaojuan Zhao, et al.,
bioRxiv - Physiology 2021
Quote:
... JON/A anti-integrin αIIbβ3 and isotype-nonspecific IgG were from Emfret Analytics (Würzburg, Germany). Hoechst 33324 ...
-
No products found
because this supplier's products are not listed.
Paweł Kozielewicz, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
... Colenterazine h was from Biosynth and it was stored as 2.4 mM aliquots in acidified ethanol at −80°C ...
-
No products found
because this supplier's products are not listed.
Aaron R. Tipton, Gary J. Gorbsky,
bioRxiv - Cell Biology 2021
Quote:
... Rabbit anti-Nuf2 (P. Todd Stukenberg; University of Virginia) and human anti-Centromere Antibodies (ACA; Antibodies Incorporated). Secondary antibodies used were goat anti-rabbit antibodies conjugated fluorescein isothiocyanate (FITC ...
-
No products found
because this supplier's products are not listed.
Victor Ruiz-Rodado, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... and A18110101 (L-amino acid diet with 2 g L-cysteine and 2 g L-cystine per kg) from Research Diets Inc ...
-
No products found
because this supplier's products are not listed.
Sang-Chul Kim, et al.,
bioRxiv - Biochemistry 2022
Quote:
... The membrane was incubated for 1 h with primary antibodies: polyclonal anti-LHY (R3095-2, Abiocode, Aguora Hills, CA), polyclonal anti-CCA1 (R1234-3 ...
-
No products found
because this supplier's products are not listed.
Anne Chouquet, et al.,
bioRxiv - Bioengineering 2021
Quote:
... Protein L biosensors (Pall/FortéBio) or lab-made IgM-specific biosensors were tested ...
-
No products found
because this supplier's products are not listed.
Cristina Herencias, et al.,
bioRxiv - Microbiology 2023
Quote:
... tetracycline (15 mg/L, Nzytech), or chloramphenicol (30 mg/L ...
-
No products found
because this supplier's products are not listed.
John C. Newman, et al.,
bioRxiv - Neuroscience 2022
Quote:
Figure 4B-H: N=9 (3M, 6F), all hAPPJ20.
-
No products found
because this supplier's products are not listed.
Ana Lambertos, Rafael Peñafiel,
bioRxiv - Biochemistry 2019
Quote:
L-[1-14C] ornithine and L-[1-14C] lysine were purchased from American Radiolabeled Chemicals Inc ...
-
No products found
because this supplier's products are not listed.
Madhumitha Narasimhan, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Fmoc-L-Thr(tBu)-OH und Fmoc-L-Val-OH were purchased from Iris Biotech with purities of 98,0% ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Changrui Lu, et al.,
bioRxiv - Molecular Biology 2022
Quote:
The IgG ELISAs for RBD were conducted by using Antibody IgG Titer Serologic Assay Kit (AcroBiosystems, RAS-T059). According to the manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Yifan Zhang, et al.,
bioRxiv - Biochemistry 2022
Quote:
... L-hercynine from Toronto Research Chemicals (H288900), L-histidine from Sigma Aldrich (H8000) ...
-
No products found
because this supplier's products are not listed.
Mouhita Humayun, et al.,
bioRxiv - Bioengineering 2022
Quote:
... L-WRN CM was prepared using L-WRN cells from American Type Culture Collection (ATCC, catalog no. CRL-3276) and a previously published protocol [111] ...
-
No products found
because this supplier's products are not listed.
Scott A. Scholz, et al.,
bioRxiv - Systems Biology 2022
Quote:
... 100 mL/L 10X ACGU (Teknova cat # M2103), 1 mL/L micronutrient solution ...
-
No products found
because this supplier's products are not listed.
Sara A. Thannickal, et al.,
bioRxiv - Microbiology 2023
Quote:
... and L segments using TransIT-LT1 reagent (Mirus) following the manufacturer’s instructions (47) ...
-
No products found
because this supplier's products are not listed.
Fabien Thery, et al.,
bioRxiv - Cell Biology 2021
Quote:
... at 10 ng/mL for 24 h (#11343596, #11343524, Immunotools). Each condition (2 baits ...
-
No products found
Meng Wu, et al.,
bioRxiv - Immunology 2023
Quote:
... The C3-expressing cells isolated from C3IRES-tdTomato C57BL/6 and WT mice were cultured and stained with goat anti-tdTomato in a 96-well plate with glass-like polymer bottom (Cellvis P96-1.5P) and imaged using a widefield microscopy to test anti-tdTomato antibody (Figure S4A-C).
-
No products found
because this supplier's products are not listed.
Mads Kuhlmann Andersen, et al.,
bioRxiv - Physiology 2022
Quote:
... which were attached to micromanipulator (M3301-M3-L, WPI) and connected to a Duo 773 electrometer (WPI) ...
-
No products found
because this supplier's products are not listed.
Christoph Spahn, et al.,
bioRxiv - Microbiology 2023
Quote:
... poly-L-lysine coated 8-well chamberslides (Sarstedt GmbH). All centrifugation steps were performed for 2 min at 6,000 g in a benchtop centrifuge (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Swapnil Rohidas Shinde, et al.,
bioRxiv - Cell Biology 2020
Quote:
... and 2 mM L-glutamine (400-106; Gemini Bio-products). The RPE1-hTERT cell line (ATCC CRL-4000 ...
-
No products found
because this supplier's products are not listed.
Christopher J. Neufeldt, et al.,
bioRxiv - Microbiology 2020
Quote:
... cells were treated for 6 h with serial dilution of IFNα2 (PBL Assay Science, 11100-1), IFNβ (R&D Systems ...
-
No products found
because this supplier's products are not listed.
Athina Varveri, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... p62 MBL (rabbit; 1:500; MBL) and LC3 (mouse; 1:20; NanoTools) (in PSI Buffer ...
-
No products found
because this supplier's products are not listed.
Toshiyuki Ueki, et al.,
bioRxiv - Synthetic Biology 2019
Quote:
... and the HA Tag Polyclonal Antibody as primary antibodies and an anti-mouse IgG-gold (40 nm) antibody (40 nm Goat Anti-Mouse IgG gold conjugate, Expedeon) and the anti-rabbit IgG-gold (10 nm ...
-
No products found
because this supplier's products are not listed.
Fan Liu, et al.,
bioRxiv - Neuroscience 2022
Quote:
... rat anti-OVA IgG (Cat: ACMOV111R) from Agro-Bio; highly selective Syk inhibitor PRT062607 (P505-15 ...
-
No products found
because this supplier's products are not listed.
Julia A Alvarez, et al.,
bioRxiv - Microbiology 2024
Quote:
... goat anti-Toxo conjugated FITC (1:400) (ViroStat, cat#0283) was also used ...
-
No products found
because this supplier's products are not listed.
Jinrui Dong, et al.,
bioRxiv - Cell Biology 2021
Quote:
... IgG (Aldevron), IL6 (AF506 ...
-
No products found
because this supplier's products are not listed.
Julien Brechbühl, et al.,
bioRxiv - Neuroscience 2021
Quote:
... pGCG (Rabbit anti-PGCG; PGCG-701AP; FabGennix; 1:250) and γTUB (Rabbit anti-gamma Tubulin ...
-
No products found
because this supplier's products are not listed.
Timothy H. S. Cho, Junshu Wang, Tracy L. Raivio,
bioRxiv - Microbiology 2022
Quote:
... anti-OmpA (rabbit polyclonal, Antibody Research Corporation, 1:5,000-10,000), anti-CpxA-MBP (rabbit polyclonal ...
-
No products found
because this supplier's products are not listed.
EmilyClare P. Baker, et al.,
bioRxiv - Evolutionary Biology 2021
Quote:
... and visualized by WesternBright™ ECL HRP Substrate (Thomas Scientific). For pulldowns visualized by western blotting CEACAM1 protein input samples were prepared by mixing 20uL of protein with 20uL 2x Laemmli then boiled at 95°C for five minutes and centrifuged at max speed for five minutes ...