-
No products found
because this supplier's products are not listed.
Hadel Al Asafen, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... goat anti-biotin (ImmunoReagents, Raleigh ...
-
No products found
because this supplier's products are not listed.
Qian Guo, et al.,
bioRxiv - Cell Biology 2024
Quote:
... goat polyclonal antibody EEA1 (A121550, Antibodies.com) (1:200 for IF).
-
No products found
because this supplier's products are not listed.
Robin Roychaudhuri, et al.,
bioRxiv - Biochemistry 2022
Quote:
... rabbit anti SLC7A10 polyclonal antibody (G-Biosciences; ITA8971).
-
No products found
because this supplier's products are not listed.
Olga Zaytseva, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... or anti-Psi (custom generated rabbit polyclonal antibody, Biomatik) antibodies overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Javier Martínez Pacheco, et al.,
bioRxiv - Plant Biology 2022
Quote:
... Rabbit AtTOR polyclonal antibodies (Abiocode, R2854-2), rabbit polyclonal S6K1/2 antibodies (Agrisera ...
-
No products found
because this supplier's products are not listed.
Maribel Donoso, et al.,
bioRxiv - Neuroscience 2020
Quote:
... chicken polyclonal anti-MAP2 (EnCor Biotech; Phosphosolutions); mouse monoclonal antibodies anti-p62 (BD Transduction Laboratories) ...
-
No products found
because this supplier's products are not listed.
Maribel Donoso, et al.,
bioRxiv - Neuroscience 2020
Quote:
... chicken polyclonal anti-MAP2 (EnCor Biotech; Phosphosolutions); mouse monoclonal antibodies anti-p62 (BD Transduction Laboratories) ...
-
No products found
because this supplier's products are not listed.
Prakash Thapa, et al.,
bioRxiv - Immunology 2019
Quote:
... anti-Vα24 antibody (Beckman Coulter), and anti-CD3 and anti-CD4 antibodies (eBioscience).
-
Cat# AG149-1,
USD $95.0/ml
Ask
Shaowen White, My Tran, Richard J. Roller,
bioRxiv - Cell Biology 2022
Quote:
... mouse polyclonal anti-gE antibody (Virusys) 1:500 ...
-
No products found
because this supplier's products are not listed.
Lioba Ester, et al.,
bioRxiv - Cell Biology 2023
Quote:
... anti-NUP205 rabbit polyclonal antibody (Biomol, A303-935A), anti-YAP rabbit polyclonal antibody (Cell Signaling ...
-
No products found
Jennifer Hampton Hill, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... an anti-His rabbit polyclonal antibody (ABM, Richland, BC, Canada) in combination with a polyclonal goat anti-rabbit HRP conjugated secondary antibody (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Csaba Matta, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Bound primary antibodies were detected with goat anti-rabbit or goat anti-mouse antibodies conjugated with alkaline phosphatase (Cambridge Bioscience), IRDye® 680RD or IRDye® 800CW (Licor) ...
-
No products found
because this supplier's products are not listed.
Anil G Cashikar, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Goat anti-rabbit HRP secondary antibody (Leinco Technologies, R115); Goat Anti-rabbit Alexa 555 (Invitrogen ...
-
No products found
because this supplier's products are not listed.
Gareth T. Powell, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... anti-GFP (AB_10013661, rabbit polyclonal, Torrey Pines Biolab, diluted 1:1000 ...
-
No products found
because this supplier's products are not listed.
Delphine Bonhomme, et al.,
bioRxiv - Immunology 2020
Quote:
... The supernatants were discarded before staining with 50 μL of 2 μg/mL secondary AF488 goat anti rabbit (goat IgG H+L, Invivogen) in cytometry buffer for 30 min on ice ...
-
No products found
because this supplier's products are not listed.
Bixia Hong, et al.,
bioRxiv - Microbiology 2020
Quote:
... anti-SSEA-4 antibody (STEMCELL Technologies), anti-Sox17 antibody (R&D System) ...
-
No products found
because this supplier's products are not listed.
Khem Raj Giri, et al.,
bioRxiv - Immunology 2020
Quote:
... polyclonal rabbit anti-calnexin antibody (1:1000; Euromedex, Souffelweyersheim, France), β–actin (W16197A ...
-
No products found
because this supplier's products are not listed.
Trevor J. Edwards, Jennifer L. Edwards,
bioRxiv - Microbiology 2022
Quote:
... Western Blots were probed with anti-C3 polyclonal antibody (Quidel).
-
No products found
because this supplier's products are not listed.
Verica Vasić, et al.,
bioRxiv - Neuroscience 2022
Quote:
... As primary antibody a polyclonal rabbit anti-human EGFL7 antibody (1:50, ReliaTech GmbH) was applied ...
-
No products found
because this supplier's products are not listed.
Jonas M. Holzinger, et al.,
bioRxiv - Microbiology 2023
Quote:
... or polyclonal anti-human BPI antibody (Cat# HM2170, RRID: AB_532911; Hycult Biotech, Uden, Netherlands) were incubated overnight at 4 °C ...
-
No products found
because this supplier's products are not listed.
Michelle Wantoch, et al.,
bioRxiv - Immunology 2020
Quote:
... anti-human interferon-α (sheep polyclonal) and anti-human interferon-β (sheep polyclonal; all from PBL Assay Science) or a control cocktail of mouse IgG2a (BioLegend ...
-
No products found
because this supplier's products are not listed.
Monique Liebers, et al.,
bioRxiv - Plant Biology 2020
Quote:
... Rabbit polyclonal antibodies against PAP8 were produced by ProteoGenix. In Western blots PAP8 is detected at ~38 kDa ...
-
No products found
because this supplier's products are not listed.
Iris. A. Unterweger, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... α-Prox1 (rabbit polyclonal antibody, 1:500, Angiobio, 11-002P) and α-2F11 (mouse monoclonal antibody ...
-
No products found
because this supplier's products are not listed.
Le Xu, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Primary antibodies with final concentrations used for immunofluorescence staining: rabbit anti-SCGB1A1 polyclonal antibody [5 mg/ml] (WRAB-3950, Seven Hills Bioreagents), mouse anti-FOXJ1 monoclonal antibody [8 mg/ml] (14-9965-80 ...
-
No products found
because this supplier's products are not listed.
MU Wagenhäuser, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... For the platelet depletion experiments mice were injected with platelet depletion antibody (Emfret Analytics, polyclonal anti-GPIb alpha #R300) and a corresponding IgG antibody (Emfret Analytics ...
-
No products found
because this supplier's products are not listed.
Lidia I. Madrid, et al.,
bioRxiv - Neuroscience 2022
Quote:
... goat anti-tdTomato (Accurate Chemical and Scientific Corporation; 1:500,) and DAPI (1:5000 ...
-
No products found
because this supplier's products are not listed.
Boris Bonaventure, et al.,
bioRxiv - Microbiology 2021
Quote:
... or J2 anti-dsRNA antibody (SCICONS), or anti-SARS-CoV-2 Nucleoprotein (N ...
-
No products found
because this supplier's products are not listed.
Hiroko Yukinaga, et al.,
bioRxiv - Neuroscience 2021
Quote:
... HRP-conjugated anti-flu antibody (AKOYA Bioscience NEF710001EA ...
-
No products found
because this supplier's products are not listed.
Junke Liu, et al.,
bioRxiv - Cell Biology 2024
Quote:
... or anti-AP2-Tb antibody (Revvity Cisbio) at final concentration of 0.5 nM for 2 h ...
-
No products found
because this supplier's products are not listed.
Yusuf Cem Eskiocak, et al.,
bioRxiv - Immunology 2021
Quote:
... Anti-mouse CD16/32 (2.4G2) antibody (Tonbo Biosciences, USA) or Human TruStain FcX (BioLegend ...
-
No products found
because this supplier's products are not listed.
Youssouf Sereme, et al.,
bioRxiv - Microbiology 2020
Quote:
... A poliovirus serology-positive control serum (Poliomyelitis virus kit, GenWay, San Diego, California, USA) was also used as a control ...
-
Goat Polyclonal Secondary Antibody to Human IgG Fc
Cat# CSA2004,
100 ul USD $30.0, 500 ul USD $75.0, 1 ml USD $112.0
Ask
Björn Kieslich, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Primary anti-GPR112 polyclonal antibody (cpa3095, Cohesion Biosciences, London, UK) was diluted 1:100 in antibody buffer (PBS ...
-
No products found
because this supplier's products are not listed.
Esther B. Florsheim, et al.,
bioRxiv - Immunology 2023
Quote:
... or rabbit polyclonal anti-Fluoro-Gold primary antibody (1:1000 Fluorochrome) in the same blocking solution overnight for 16 h and then with Alexa Fluor 594-conjugated donkey anti-rabbit IgG secondary fluorescent antibody (1:500 dilution ...
-
No products found
because this supplier's products are not listed.
Alexis M. Crockett, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Primary antibodies polyclonal rabbit anti-rat/mouse fibrinogen (1:300; Innovative research), polyclonal rabbit anti-mouse/human claudin-5 (1:300 ...
-
Cat# AB-15,
100 microliters,USD $310.0
Ask
Hartwig Seitter, et al.,
bioRxiv - Neuroscience 2020
Quote:
The rabbit polyclonal anti-melanopsin antibody (Advanced Targeting Systems Cat# AB-N39, RRID:AB_1608076) was generated against the 15 N-terminal extracellular amino acids of mouse melanopsin ...
-
No products found
because this supplier's products are not listed.
Hiroaki Itakura, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... anti-rabbit polyclonal antibody against S-100 (#422091, NICHIREI BIOSCIENCE Inc., Tokyo, Japan), anti-rabbit polyclonal antibody against CD45R (#14-0451-82 ...
-
No products found
because this supplier's products are not listed.
Lucas E. Cabrera Zapata, et al.,
bioRxiv - Neuroscience 2022
Quote:
... or anti-Npy rabbit polyclonal antibody (T-4070, Peninsula Laboratories-BMA Biomedicals, Switzerland). After rinsing with PBS ...
-
No products found
because this supplier's products are not listed.
Qingmin Zhu, et al.,
bioRxiv - Microbiology 2023
Quote:
... The cells were then incubated with FITC (fluorescein isothiocyanate)-conjugated goat anti RV polyclonal Abs (Virostat, USA) (1:100 ...
-
No products found
because this supplier's products are not listed.
Elahe Zarini-Gakiye, et al.,
bioRxiv - Neuroscience 2020
Quote:
... rabbit anti GRP87/Bip polyclonal antibody (1:600, StressMarq Biosciences, Catalogue no. SPC-180), mouse anti-ATF6 monoclonal antibody (1:750 ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Jian Li, et al.,
bioRxiv - Neuroscience 2021
Quote:
... we performed new tyrosine hydroxylase stains (rabbit polyclonal anti-tyrosine hydroxylase antibody; Pel-Freez Biologicals; Rogers AR) on tissue sections from the level of the caudal and rostral midbrain ...
-
No products found
because this supplier's products are not listed.
Xi Chen, et al.,
bioRxiv - Bioengineering 2021
Quote:
... Liver slides were stained with goat-anti-hFIX antibody (1:2000, Affinity Biologicals, GAFIX-AP). Subsequently ...
-
No products found
because this supplier's products are not listed.
Xiaojie Ji, et al.,
bioRxiv - Genetics 2021
Quote:
Antibodies against phospho-MERTK (FabGennix, PMKT-140AP, rabbit polyclonal, 1:750), 4-HNE (Abcam ...
-
No products found
because this supplier's products are not listed.
Nikita P. Patil, et al.,
bioRxiv - Physiology 2022
Quote:
Monolayers of HCAEC grown in Transwell membranes were stained for heparan sulfate using mouse monoclonal anti-heparan sulfate antibody (10E4 epitope, 1:100 in 2% goat serum, AMSBIO) following previously established protocols.[31] Briefly ...
-
No products found
because this supplier's products are not listed.
Rose Blake, et al.,
bioRxiv - Microbiology 2023
Quote:
... anti-His monoclonal antibody (Raybiotech) and goat anti-rabbit IgG were used as primary and secondary antibodies (Supplementary Table 1) ...
-
No products found
because this supplier's products are not listed.
Chao Wang, et al.,
bioRxiv - Cell Biology 2019
Quote:
... anti-mouse-HRP antibody (ImmunoVision Technologies) was added and the cells were incubated with the secondary antibody for 2 hrs ...
-
No products found
because this supplier's products are not listed.
Ling Li, et al.,
bioRxiv - Immunology 2023
Quote:
... HRP–conjugated goat anti-human antibodies (Zen-bio, 550004; 1:5000 dilution) were added to the wells and incubated at 37°C for 1hr ...
-
No products found
because this supplier's products are not listed.
Nicholas Don-Doncow, et al.,
bioRxiv - Physiology 2021
Quote:
... goat anti-rabbit or goat anti-rat Fluor 594 (Nordic Biosite, Sweden) were used for visualization ...
-
No products found
because this supplier's products are not listed.
Ana Bello-Gamboa, et al.,
bioRxiv - Immunology 2020
Quote:
... Rabbit polyclonal anti-phospho-Thr538 paxillin for WB and immunofluorescence (ECM Biosciences). Rabbit polyclonal Phospho-(Ser ...
-
No products found
because this supplier's products are not listed.
Arjun Kalvala, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... and anti-CD81 antibodies (System Biosciences, CA).